SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8808 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8808
Domain Number 1 Region: 435-517
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000275
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.8808
Sequence length 539
Comment $ NYCOMPS $ SQ227459 $ PDBT340329 $
Sequence
MNEKINTNETKDLKNKIVELVIPKNGSVKNDVLSGLTVALALVPEAIAFSFILGIDPTIG
LYAAFIMGIVTALIGGRPGMISGATGAVAVIFAPLVISKVQTSGMESALGHLFIAVLFMG
IIQVFFGISKVGKFVRLIPHPVMLGFVNGLAIIIFLSQLGQFYGADGNLLPWPILSVMLI
LIVITMIIAIYLPKITRAVPATLVAIITVTIISYFLNNAGYTVLTVLDFIKSIEPLKTTL
AVSVPSFALPNVPLNWDTVKTVLPYSFLAACVGLIESLMTLRLIDELTETRGRSNRECIG
QGIANILNGFFGGMGGCAMIGQSMINIRGGGRGRLSGISAAILLLIFIVWGAPIIEMIPL
AALVGVMFIVVIGTFEWSSFRILKKIPSSDAAIIAVVSIMTVVFNLATAVFLGIILAALV
FAWNRGKDIWASTKSMKNKKVYMLHGPLFFASTSKFKSLFDYQNDPIDVVIDFNKSRVYD
HSAIEAINSVAEKYTQHGKQLHLLNLSRDCDKLIKKADNIVEVSILDNLIWHVADDELE
Download sequence
Identical sequences A4FYD3
WP_011868671.1.72418 GO.8808 gi|134045946|ref|YP_001097432.1| 402880.MmarC5_0911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]