SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8824 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GO.8824
Domain Number - Region: 412-481
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000667
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.8824
Sequence length 489
Comment $ NYCOMPS $ SQ227474 $ PDBT340345 $
Sequence
MNTLRQDSLAGIVVFLVALPLCLGIAQASGLPPFVGLLTGIIGGLVVTTLSPSRFAVSGP
AAGLVTIVVAAIESLGSFSLFLMALVLAGVLQLLFGILRAGRFISLVPASVIKGMLAAIG
ILLIMQQIPVALGTAEETGLAEVVQGNAAVSVTAFAVAAGGLLVLWLWGSPLIRRVKSLR
WIPGPLIAVLLGCVTTLLLTHFAPQQLAALPRITLPAFGSLGDLLGELESPAWSAWRNPS
VWVVAVTLALVASLETLLSQEALKKLRPQNPPPSPNREMVAQGVGNLLSGVLGAMPITAV
IVRSSVNVSNGAQSKLSIFIHGLLLLICGLWFSGLLTLIPLASLAAVLLYTGYKLATPRL
FIEQFRQGAAQYVPFLATIGGIIACGMLAGIGIGLATQMAFSLWRSHRHSLQLARYDDHY
VLRIQQNLTFMHNPHLLALLAKIPEKSVVIVEHDSVGYLDPDVRAVLDDFAENAPQRGIR
LNQWPLASR
Download sequence
Identical sequences A6THK1
272620.KPN_04684 gi|152973156|ref|YP_001338302.1| WP_015959323.1.18736 WP_015959323.1.26336 WP_015959323.1.38448 WP_015959323.1.41405 WP_015959323.1.48606 WP_015959323.1.49877 WP_015959323.1.86778 WP_015959323.1.96842 WP_015959323.1.98450 GO.8824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]