SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8826 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8826
Domain Number 1 Region: 426-503
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000137
Family Anti-sigma factor antagonist SpoIIaa 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.8826
Sequence length 517
Comment $ NYCOMPS $ SQ227476 $ PDBT340347 $
Sequence
MWTRLLPFLAWLPGLHRGMLGREAWVGLNGAILALPQSMAYALIAGLPAEYGLYAAMLPV
AIACLWGSSRYLVSGPTAAISVLLFSSVAPLAPLGSPQYVQAVLLLTFLAGAFQWLLGVL
RVGSLVNFVSHSVMLGFTLGAALLIVLGQLPYLLGLAASGEGAAPGNGWRLLARFAEFDG
PSLLVGGFSFALSLLVRRLRPRWPALLLGLLGGATLVWALPGTFASVAHVQALSSALPGW
SPLVFDSRSILDLLPAAVACGMLGLVTSLSIARALAARQGDAFDANQEVRAQGLSNLLGP
WLSASLSAGSFTRSGLNLEAGARSPLAGAFSALWVALLAVLGARLIEHVPLPAMAAGILL
IAWGLIDRPALRALYRSGRAECLVAGLTALATLLLPLQNAIYAGVLASLVFYLRRTSTPR
VLRQRNDEEEVLRIEGSIFFGACDYLQRLMRQCDRPRLVLDARQVNFIDFAGAVLLQQEA
RRLHAEGRRLVLRHARPQVREALGRQADEGCRLHYEG
Download sequence
Identical sequences Q9I7A1
gi|15595227|ref|NP_248719.1| gi|218888775|ref|YP_002437639.1| GO.8826 208964.PA0029 557722.PLES_00281 NP_248719.1.87394 WP_003114638.1.101712 WP_003114638.1.11026 WP_003114638.1.11163 WP_003114638.1.11943 WP_003114638.1.12354 WP_003114638.1.12561 WP_003114638.1.12891 WP_003114638.1.13232 WP_003114638.1.1333 WP_003114638.1.1393 WP_003114638.1.14714 WP_003114638.1.1475 WP_003114638.1.18653 WP_003114638.1.19269 WP_003114638.1.19741 WP_003114638.1.21517 WP_003114638.1.22863 WP_003114638.1.23195 WP_003114638.1.23715 WP_003114638.1.24351 WP_003114638.1.24879 WP_003114638.1.251 WP_003114638.1.25142 WP_003114638.1.2535 WP_003114638.1.26489 WP_003114638.1.26681 WP_003114638.1.26705 WP_003114638.1.27575 WP_003114638.1.27687 WP_003114638.1.27837 WP_003114638.1.29577 WP_003114638.1.31279 WP_003114638.1.32544 WP_003114638.1.33210 WP_003114638.1.3376 WP_003114638.1.34832 WP_003114638.1.35480 WP_003114638.1.35857 WP_003114638.1.36521 WP_003114638.1.38102 WP_003114638.1.38502 WP_003114638.1.39088 WP_003114638.1.41502 WP_003114638.1.41773 WP_003114638.1.41871 WP_003114638.1.42778 WP_003114638.1.43662 WP_003114638.1.43667 WP_003114638.1.44959 WP_003114638.1.45090 WP_003114638.1.45485 WP_003114638.1.45934 WP_003114638.1.46152 WP_003114638.1.47774 WP_003114638.1.48413 WP_003114638.1.50653 WP_003114638.1.50967 WP_003114638.1.51501 WP_003114638.1.52244 WP_003114638.1.52690 WP_003114638.1.53267 WP_003114638.1.53486 WP_003114638.1.53530 WP_003114638.1.53719 WP_003114638.1.55347 WP_003114638.1.56797 WP_003114638.1.58689 WP_003114638.1.59076 WP_003114638.1.60415 WP_003114638.1.60603 WP_003114638.1.62357 WP_003114638.1.62516 WP_003114638.1.62534 WP_003114638.1.62701 WP_003114638.1.65066 WP_003114638.1.65099 WP_003114638.1.66526 WP_003114638.1.67388 WP_003114638.1.67686 WP_003114638.1.68568 WP_003114638.1.68857 WP_003114638.1.68862 WP_003114638.1.71822 WP_003114638.1.72331 WP_003114638.1.73149 WP_003114638.1.73455 WP_003114638.1.75303 WP_003114638.1.75825 WP_003114638.1.75938 WP_003114638.1.77566 WP_003114638.1.77574 WP_003114638.1.78430 WP_003114638.1.80033 WP_003114638.1.80632 WP_003114638.1.81771 WP_003114638.1.84374 WP_003114638.1.84715 WP_003114638.1.84754 WP_003114638.1.86002 WP_003114638.1.86545 WP_003114638.1.87435 WP_003114638.1.87987 WP_003114638.1.88680 WP_003114638.1.89867 WP_003114638.1.90189 WP_003114638.1.91431 WP_003114638.1.9182 WP_003114638.1.92175 WP_003114638.1.92624 WP_003114638.1.92769 WP_003114638.1.94385 WP_003114638.1.95802 WP_003114638.1.9722 WP_003114638.1.98600 WP_003114638.1.99461 WP_003114638.1.99654 WP_003114638.1.99757 gi|568151214|ref|YP_008940159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]