SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8832 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8832
Domain Number 1 Region: 400-485
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.8832
Sequence length 495
Comment $ NYCOMPS $ SQ179680 $ PDBT340353 $
Sequence
MLQTLKQNWFSNLRGDLLAGLVVALALIPEAIAFSIIAGVDPKIGLYASFSMAVVIAFAG
GRPGMISAATGAMALLMVNLVKDHGLQYLLAATLLCGVLQILAGYLRLGSLMRFVSRSVV
TGFVNALAILIFMAQLPELTDVGWPVYAMTAAGLAIVYGFPHLPRIGRLLPSPLVCILVL
TGISIYLGLDIRTVGDMGQLPDSLPLFLWPDVPLNLDTLLIVLPYSAALAVVGLLESLMT
ATIVDEMTDTGSDKNRECKGQGLANIATGLLGGMAGCAMIGQSVINVKSGGRSRLSTLVA
GVALLLMVVFLSDWVGRIPMAALVAVMIMVSIGTFRWESIRNLKRYPLSTNLVMLVTVGV
VLATHNLAFGVVAGVLLASLFFANKIGHYLDIDSERSADGTRRHYQVSGQVFFASSGRFV
AAFDLKETLEHVLIDLRHAHLWDVTAVAALDKVVLGFRQRGVQVDVLGLNAASATLVDRF
GAYDKPGAVDILSDH
Download sequence
Identical sequences Q9I0S2
NP_251253.1.87394 WP_003115333.1.10419 WP_003115333.1.11454 WP_003115333.1.15281 WP_003115333.1.18653 WP_003115333.1.21718 WP_003115333.1.21767 WP_003115333.1.22729 WP_003115333.1.24101 WP_003115333.1.24879 WP_003115333.1.26489 WP_003115333.1.28258 WP_003115333.1.28372 WP_003115333.1.29096 WP_003115333.1.29481 WP_003115333.1.34317 WP_003115333.1.35480 WP_003115333.1.41773 WP_003115333.1.41871 WP_003115333.1.43024 WP_003115333.1.43106 WP_003115333.1.44739 WP_003115333.1.48413 WP_003115333.1.49266 WP_003115333.1.49842 WP_003115333.1.50653 WP_003115333.1.51501 WP_003115333.1.51585 WP_003115333.1.5226 WP_003115333.1.55347 WP_003115333.1.59797 WP_003115333.1.60600 WP_003115333.1.62357 WP_003115333.1.6280 WP_003115333.1.63057 WP_003115333.1.64799 WP_003115333.1.65066 WP_003115333.1.68857 WP_003115333.1.68910 WP_003115333.1.70460 WP_003115333.1.73455 WP_003115333.1.76399 WP_003115333.1.77286 WP_003115333.1.81082 WP_003115333.1.81771 WP_003115333.1.84398 WP_003115333.1.84702 WP_003115333.1.85910 WP_003115333.1.91803 WP_003115333.1.92175 WP_003115333.1.92454 WP_003115333.1.92924 WP_003115333.1.94174 WP_003115333.1.94243 WP_003115333.1.95025 WP_003115333.1.98600 208964.PA2563 gi|15597759|ref|NP_251253.1| APC64875 GO.8832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]