SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8840 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8840
Domain Number 1 Region: 441-542
Classification Level Classification E-value
Superfamily SpoIIaa-like 1e-17
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.8840
Sequence length 553
Comment $ NYCOMPS $ SQ227485 $ PDBT340361 $
Sequence
MFAIYESYKAGQLQPKQWVNNITAGLIVGVVALPLAMAFAIASGVKPEQGIYTAIIAGII
VSLFGGSRVQIAGPTGAFIVILAGIVAEHGVAGLQIATIMAGFILVVLGLARLGSIIRYI
PDPVIVGFTSGIGVIIWVGQWRDFFGLPEIKGEHFHQKLVAIFHAFPQFHLTTTLLALLS
LALVIFGPKIPKLSKIPGPLLALVVVTSLQYVVGFEGVRTIGSAFGGIPQGLPEFALPDL
SLSQMIQLIGPAFAIAMLGAIESLLSAVVADGMAGTKHNSNQELVGQGIANIVAPLFGGI
AATGAIARTATNIRNGGNSPIAGVMHALTLVIILLVLAPLAVNIPLATLSAILFVVAWNM
SEAPHFVQLAKRAPRADVAILLLTFGLTVFADLVVAVNIGVIIAMLHFVKRMASSVEVKA
NGSQEMSYELAQHGRSTLPRELAVYALEGPFFFAAAETFERVMGSIQETPQILILRLKWV
PFMDITGIQTLEEMIQSFHKRGIKVLISGANSRVSQKLVKAGIVKLVGEQNVYPVFEGAL
SAALTEIEAQPTE
Download sequence
Identical sequences A0A085QNW2 A0A0H3Q353 A0A0K9UXT9 A0A0X1L1R1 C3LUA2 Q9KN88
gi|227811704|ref|YP_002811714.1| gi|229605223|ref|YP_002875927.1| GO.8840 NP_232478.1.72393 WP_000457419.1.100264 WP_000457419.1.100388 WP_000457419.1.100440 WP_000457419.1.100659 WP_000457419.1.10071 WP_000457419.1.100976 WP_000457419.1.101051 WP_000457419.1.101117 WP_000457419.1.10121 WP_000457419.1.101220 WP_000457419.1.101314 WP_000457419.1.101507 WP_000457419.1.101933 WP_000457419.1.102054 WP_000457419.1.1024 WP_000457419.1.10453 WP_000457419.1.10626 WP_000457419.1.10834 WP_000457419.1.10887 WP_000457419.1.11270 WP_000457419.1.11351 WP_000457419.1.11879 WP_000457419.1.11885 WP_000457419.1.11965 WP_000457419.1.12252 WP_000457419.1.12262 WP_000457419.1.12332 WP_000457419.1.12525 WP_000457419.1.12527 WP_000457419.1.12548 WP_000457419.1.12590 WP_000457419.1.12686 WP_000457419.1.12902 WP_000457419.1.13053 WP_000457419.1.13155 WP_000457419.1.13156 WP_000457419.1.13395 WP_000457419.1.13454 WP_000457419.1.13652 WP_000457419.1.13725 WP_000457419.1.14080 WP_000457419.1.14263 WP_000457419.1.14904 WP_000457419.1.14995 WP_000457419.1.15109 WP_000457419.1.15179 WP_000457419.1.15200 WP_000457419.1.15516 WP_000457419.1.15786 WP_000457419.1.15997 WP_000457419.1.16115 WP_000457419.1.16351 WP_000457419.1.16382 WP_000457419.1.17232 WP_000457419.1.17295 WP_000457419.1.17621 WP_000457419.1.18375 WP_000457419.1.18392 WP_000457419.1.18447 WP_000457419.1.18484 WP_000457419.1.18577 WP_000457419.1.18845 WP_000457419.1.18862 WP_000457419.1.18916 WP_000457419.1.19126 WP_000457419.1.19128 WP_000457419.1.19442 WP_000457419.1.19503 WP_000457419.1.19597 WP_000457419.1.20065 WP_000457419.1.20107 WP_000457419.1.20379 WP_000457419.1.20404 WP_000457419.1.20595 WP_000457419.1.20602 WP_000457419.1.20669 WP_000457419.1.20699 WP_000457419.1.20758 WP_000457419.1.21073 WP_000457419.1.21179 WP_000457419.1.21279 WP_000457419.1.21281 WP_000457419.1.21558 WP_000457419.1.21671 WP_000457419.1.21717 WP_000457419.1.21764 WP_000457419.1.21815 WP_000457419.1.21866 WP_000457419.1.22521 WP_000457419.1.22773 WP_000457419.1.229 WP_000457419.1.22953 WP_000457419.1.2304 WP_000457419.1.23134 WP_000457419.1.23333 WP_000457419.1.23361 WP_000457419.1.2341 WP_000457419.1.23416 WP_000457419.1.23424 WP_000457419.1.23532 WP_000457419.1.23538 WP_000457419.1.2354 WP_000457419.1.23808 WP_000457419.1.23955 WP_000457419.1.240 WP_000457419.1.2401 WP_000457419.1.24106 WP_000457419.1.24280 WP_000457419.1.24345 WP_000457419.1.24399 WP_000457419.1.2496 WP_000457419.1.24980 WP_000457419.1.26020 WP_000457419.1.26156 WP_000457419.1.2627 WP_000457419.1.26326 WP_000457419.1.26508 WP_000457419.1.26580 WP_000457419.1.27186 WP_000457419.1.27435 WP_000457419.1.27458 WP_000457419.1.27639 WP_000457419.1.27822 WP_000457419.1.27863 WP_000457419.1.28431 WP_000457419.1.29095 WP_000457419.1.29535 WP_000457419.1.29708 WP_000457419.1.29889 WP_000457419.1.30045 WP_000457419.1.30107 WP_000457419.1.30292 WP_000457419.1.3032 WP_000457419.1.30360 WP_000457419.1.3054 WP_000457419.1.30927 WP_000457419.1.31096 WP_000457419.1.31396 WP_000457419.1.31718 WP_000457419.1.31853 WP_000457419.1.31964 WP_000457419.1.32111 WP_000457419.1.32264 WP_000457419.1.32271 WP_000457419.1.32814 WP_000457419.1.32942 WP_000457419.1.32955 WP_000457419.1.33093 WP_000457419.1.33625 WP_000457419.1.33811 WP_000457419.1.33819 WP_000457419.1.34108 WP_000457419.1.34133 WP_000457419.1.34195 WP_000457419.1.34634 WP_000457419.1.3514 WP_000457419.1.35201 WP_000457419.1.35266 WP_000457419.1.35630 WP_000457419.1.35880 WP_000457419.1.35881 WP_000457419.1.3635 WP_000457419.1.36354 WP_000457419.1.36384 WP_000457419.1.36441 WP_000457419.1.36513 WP_000457419.1.36668 WP_000457419.1.36686 WP_000457419.1.36874 WP_000457419.1.36956 WP_000457419.1.36973 WP_000457419.1.37054 WP_000457419.1.37260 WP_000457419.1.37262 WP_000457419.1.37676 WP_000457419.1.37784 WP_000457419.1.37999 WP_000457419.1.38420 WP_000457419.1.38590 WP_000457419.1.39208 WP_000457419.1.39514 WP_000457419.1.39675 WP_000457419.1.39853 WP_000457419.1.39933 WP_000457419.1.40039 WP_000457419.1.40152 WP_000457419.1.40346 WP_000457419.1.40433 WP_000457419.1.40459 WP_000457419.1.40470 WP_000457419.1.40484 WP_000457419.1.40491 WP_000457419.1.40542 WP_000457419.1.40740 WP_000457419.1.41284 WP_000457419.1.41538 WP_000457419.1.41569 WP_000457419.1.41573 WP_000457419.1.4175 WP_000457419.1.41883 WP_000457419.1.42128 WP_000457419.1.42152 WP_000457419.1.42498 WP_000457419.1.42617 WP_000457419.1.4272 WP_000457419.1.4284 WP_000457419.1.42853 WP_000457419.1.42865 WP_000457419.1.42885 WP_000457419.1.43103 WP_000457419.1.43222 WP_000457419.1.43335 WP_000457419.1.43407 WP_000457419.1.4365 WP_000457419.1.43884 WP_000457419.1.439 WP_000457419.1.44555 WP_000457419.1.44569 WP_000457419.1.44709 WP_000457419.1.44730 WP_000457419.1.45055 WP_000457419.1.45127 WP_000457419.1.45155 WP_000457419.1.45206 WP_000457419.1.45264 WP_000457419.1.45372 WP_000457419.1.45704 WP_000457419.1.45842 WP_000457419.1.45903 WP_000457419.1.45958 WP_000457419.1.46118 WP_000457419.1.46146 WP_000457419.1.46486 WP_000457419.1.4661 WP_000457419.1.4701 WP_000457419.1.47202 WP_000457419.1.4730 WP_000457419.1.4731 WP_000457419.1.47417 WP_000457419.1.47428 WP_000457419.1.47736 WP_000457419.1.47796 WP_000457419.1.47846 WP_000457419.1.47942 WP_000457419.1.48305 WP_000457419.1.48659 WP_000457419.1.48715 WP_000457419.1.488 WP_000457419.1.48874 WP_000457419.1.48927 WP_000457419.1.48984 WP_000457419.1.49238 WP_000457419.1.49317 WP_000457419.1.49593 WP_000457419.1.50254 WP_000457419.1.50277 WP_000457419.1.50577 WP_000457419.1.50625 WP_000457419.1.50813 WP_000457419.1.50822 WP_000457419.1.50980 WP_000457419.1.51160 WP_000457419.1.51177 WP_000457419.1.51661 WP_000457419.1.5201 WP_000457419.1.52391 WP_000457419.1.5320 WP_000457419.1.53214 WP_000457419.1.5397 WP_000457419.1.54191 WP_000457419.1.5425 WP_000457419.1.54398 WP_000457419.1.5450 WP_000457419.1.54706 WP_000457419.1.54901 WP_000457419.1.55092 WP_000457419.1.55665 WP_000457419.1.55929 WP_000457419.1.55932 WP_000457419.1.56429 WP_000457419.1.56785 WP_000457419.1.56807 WP_000457419.1.57098 WP_000457419.1.57148 WP_000457419.1.57300 WP_000457419.1.57518 WP_000457419.1.57546 WP_000457419.1.57678 WP_000457419.1.57945 WP_000457419.1.58295 WP_000457419.1.58367 WP_000457419.1.58596 WP_000457419.1.58844 WP_000457419.1.58975 WP_000457419.1.59010 WP_000457419.1.59194 WP_000457419.1.59378 WP_000457419.1.59394 WP_000457419.1.59554 WP_000457419.1.59633 WP_000457419.1.59741 WP_000457419.1.59916 WP_000457419.1.60216 WP_000457419.1.60386 WP_000457419.1.60633 WP_000457419.1.60694 WP_000457419.1.60800 WP_000457419.1.60955 WP_000457419.1.61169 WP_000457419.1.61523 WP_000457419.1.61624 WP_000457419.1.61644 WP_000457419.1.61753 WP_000457419.1.61869 WP_000457419.1.61875 WP_000457419.1.61935 WP_000457419.1.62165 WP_000457419.1.62324 WP_000457419.1.62425 WP_000457419.1.63347 WP_000457419.1.63546 WP_000457419.1.63655 WP_000457419.1.6366 WP_000457419.1.63723 WP_000457419.1.63749 WP_000457419.1.63779 WP_000457419.1.63911 WP_000457419.1.64201 WP_000457419.1.64253 WP_000457419.1.64315 WP_000457419.1.64382 WP_000457419.1.64441 WP_000457419.1.65007 WP_000457419.1.65051 WP_000457419.1.65086 WP_000457419.1.66329 WP_000457419.1.66633 WP_000457419.1.66696 WP_000457419.1.67770 WP_000457419.1.67839 WP_000457419.1.68424 WP_000457419.1.68506 WP_000457419.1.68723 WP_000457419.1.68863 WP_000457419.1.68925 WP_000457419.1.69049 WP_000457419.1.69085 WP_000457419.1.69157 WP_000457419.1.69843 WP_000457419.1.69857 WP_000457419.1.70069 WP_000457419.1.70176 WP_000457419.1.70247 WP_000457419.1.7049 WP_000457419.1.70813 WP_000457419.1.70892 WP_000457419.1.71129 WP_000457419.1.72106 WP_000457419.1.72241 WP_000457419.1.72326 WP_000457419.1.72361 WP_000457419.1.72369 WP_000457419.1.7238 WP_000457419.1.72480 WP_000457419.1.72856 WP_000457419.1.72964 WP_000457419.1.73148 WP_000457419.1.73429 WP_000457419.1.73555 WP_000457419.1.73855 WP_000457419.1.73929 WP_000457419.1.74111 WP_000457419.1.74503 WP_000457419.1.74666 WP_000457419.1.74991 WP_000457419.1.75012 WP_000457419.1.75326 WP_000457419.1.75378 WP_000457419.1.75778 WP_000457419.1.75796 WP_000457419.1.76320 WP_000457419.1.76425 WP_000457419.1.76486 WP_000457419.1.7654 WP_000457419.1.76645 WP_000457419.1.77029 WP_000457419.1.7717 WP_000457419.1.77355 WP_000457419.1.77397 WP_000457419.1.77445 WP_000457419.1.77703 WP_000457419.1.77794 WP_000457419.1.77830 WP_000457419.1.77914 WP_000457419.1.78157 WP_000457419.1.78172 WP_000457419.1.78531 WP_000457419.1.78740 WP_000457419.1.79044 WP_000457419.1.79776 WP_000457419.1.79943 WP_000457419.1.80024 WP_000457419.1.8023 WP_000457419.1.80339 WP_000457419.1.80500 WP_000457419.1.80618 WP_000457419.1.80628 WP_000457419.1.80702 WP_000457419.1.80744 WP_000457419.1.80808 WP_000457419.1.8117 WP_000457419.1.81871 WP_000457419.1.81917 WP_000457419.1.82119 WP_000457419.1.82193 WP_000457419.1.82248 WP_000457419.1.82262 WP_000457419.1.82413 WP_000457419.1.82583 WP_000457419.1.83040 WP_000457419.1.83073 WP_000457419.1.83082 WP_000457419.1.83109 WP_000457419.1.83703 WP_000457419.1.83761 WP_000457419.1.84519 WP_000457419.1.84610 WP_000457419.1.8480 WP_000457419.1.85007 WP_000457419.1.85086 WP_000457419.1.85388 WP_000457419.1.85498 WP_000457419.1.85822 WP_000457419.1.85878 WP_000457419.1.85961 WP_000457419.1.85972 WP_000457419.1.85998 WP_000457419.1.86057 WP_000457419.1.86192 WP_000457419.1.86269 WP_000457419.1.86874 WP_000457419.1.86879 WP_000457419.1.87286 WP_000457419.1.87335 WP_000457419.1.87355 WP_000457419.1.87573 WP_000457419.1.87602 WP_000457419.1.87625 WP_000457419.1.87804 WP_000457419.1.88057 WP_000457419.1.88230 WP_000457419.1.88283 WP_000457419.1.88350 WP_000457419.1.88556 WP_000457419.1.8867 WP_000457419.1.89441 WP_000457419.1.89822 WP_000457419.1.89889 WP_000457419.1.8997 WP_000457419.1.89995 WP_000457419.1.90120 WP_000457419.1.90133 WP_000457419.1.90227 WP_000457419.1.90437 WP_000457419.1.90675 WP_000457419.1.90774 WP_000457419.1.90889 WP_000457419.1.91247 WP_000457419.1.91262 WP_000457419.1.91274 WP_000457419.1.91539 WP_000457419.1.91747 WP_000457419.1.91794 WP_000457419.1.91841 WP_000457419.1.92038 WP_000457419.1.92063 WP_000457419.1.92069 WP_000457419.1.92157 WP_000457419.1.92401 WP_000457419.1.92412 WP_000457419.1.92516 WP_000457419.1.92559 WP_000457419.1.92632 WP_000457419.1.92696 WP_000457419.1.92703 WP_000457419.1.92952 WP_000457419.1.92993 WP_000457419.1.9302 WP_000457419.1.93060 WP_000457419.1.93399 WP_000457419.1.93441 WP_000457419.1.93836 WP_000457419.1.93945 WP_000457419.1.94255 WP_000457419.1.94426 WP_000457419.1.94441 WP_000457419.1.94481 WP_000457419.1.94774 WP_000457419.1.94827 WP_000457419.1.94887 WP_000457419.1.95516 WP_000457419.1.95549 WP_000457419.1.9561 WP_000457419.1.95662 WP_000457419.1.95733 WP_000457419.1.95976 WP_000457419.1.9607 WP_000457419.1.96089 WP_000457419.1.96187 WP_000457419.1.96311 WP_000457419.1.96471 WP_000457419.1.9660 WP_000457419.1.96687 WP_000457419.1.96704 WP_000457419.1.96980 WP_000457419.1.97100 WP_000457419.1.97144 WP_000457419.1.97288 WP_000457419.1.97516 WP_000457419.1.97552 WP_000457419.1.97562 WP_000457419.1.97650 WP_000457419.1.97799 WP_000457419.1.97832 WP_000457419.1.9787 WP_000457419.1.98021 WP_000457419.1.98116 WP_000457419.1.98172 WP_000457419.1.98246 WP_000457419.1.98280 WP_000457419.1.98373 WP_000457419.1.98624 WP_000457419.1.98642 WP_000457419.1.99128 WP_000457419.1.99204 WP_000457419.1.99417 WP_000457419.1.99452 WP_000457419.1.995 WP_000457419.1.99861 WP_000457419.1.99872 WP_000457419.1.99949 WP_000457419.1.99992 gi|15600848|ref|NP_232478.1| gi|379743526|ref|YP_005334578.1| gi|384422601|ref|YP_005631960.1| 243277.VCA0077 579112.VCM66_A0075 593588.VCD_000163 gi|360038081|ref|YP_004939843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]