SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8841 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8841
Domain Number 1 Region: 449-541
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000785
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 
Weak hits

Sequence:  GO.8841
Domain Number - Region: 182-409
Classification Level Classification E-value
Superfamily SNF-like 0.0102
Family SNF-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.8841
Sequence length 592
Comment $ NYCOMPS $ SQ227486 $ PDBT340362 $
Sequence
MNEVKAVWIRQWFPGLYQFKDYQRGWLTDDVRAAFSVVAVALPVAIAYAQLTGVPAIVGL
YSCVLPMLVYALMGTSRQLIVGPDAATCAVIAAVVTPLAAGDTTKHWQLVMTMTAMTGFW
CILASRLKLGIFADFLSRPILLGLLNGVALTIIVGQFAKVLGLKYEKRYLLERIVEAPEL
LYSLHWQTLGLSALTLAIYLVIKRWQPRWPAAMFAIMVAALLVWALNLESVGVQVVGVIQ
GGLPEFQAPAFDLGISRELVMPALNLAMVSFVSMMLTARSFAAKNGYDIDADKEFRALGV
ANVAAAFSQGFAISGADSRTAVNDANGGKSQLVSVIAALFIALVAVFAYQPLQFIPVAAL
GVVLIIASLSLLDLKGVWNLRKRDKDAFYLALITFIAVLVIGVIPGITLAVLLGLFQFLK
LVMRPTDQMMGLDEEGTLRTLDGSEKAKPIPGMVIFRFNSPLTYFNAPYFKRRILDQTER
EGAQVGCVIIDAVASFTHLDLSVMAMLADLHGILKKRGIRLILAGRKRSLRHWCDLTGIN
TAEGGIVLRADMYLAIKLSGCYLSAMEEGHVPVVQKEPDISVLLKPTTTEVA
Download sequence
Identical sequences A0A0H3AG03 A0A0H3Q3I6 A0A0H4JTP9 A0A0K9UWG4 A0A0X1L1M3 A0A2J9TK13 C2HYQ9 C3LUC7 Q9KN62
NP_232504.1.72393 WP_001006513.1.100440 WP_001006513.1.10071 WP_001006513.1.100976 WP_001006513.1.101117 WP_001006513.1.10121 WP_001006513.1.101220 WP_001006513.1.101314 WP_001006513.1.101507 WP_001006513.1.101933 WP_001006513.1.102054 WP_001006513.1.1024 WP_001006513.1.10626 WP_001006513.1.10887 WP_001006513.1.11270 WP_001006513.1.11351 WP_001006513.1.11879 WP_001006513.1.11965 WP_001006513.1.12252 WP_001006513.1.12262 WP_001006513.1.12332 WP_001006513.1.12527 WP_001006513.1.12548 WP_001006513.1.12590 WP_001006513.1.12686 WP_001006513.1.12828 WP_001006513.1.13053 WP_001006513.1.13155 WP_001006513.1.13156 WP_001006513.1.13454 WP_001006513.1.13652 WP_001006513.1.14080 WP_001006513.1.14179 WP_001006513.1.14263 WP_001006513.1.14353 WP_001006513.1.14553 WP_001006513.1.14904 WP_001006513.1.14995 WP_001006513.1.15109 WP_001006513.1.15134 WP_001006513.1.15179 WP_001006513.1.15200 WP_001006513.1.15516 WP_001006513.1.15786 WP_001006513.1.15919 WP_001006513.1.15997 WP_001006513.1.16351 WP_001006513.1.16382 WP_001006513.1.17001 WP_001006513.1.17232 WP_001006513.1.17295 WP_001006513.1.17621 WP_001006513.1.17738 WP_001006513.1.18375 WP_001006513.1.18392 WP_001006513.1.18447 WP_001006513.1.18484 WP_001006513.1.18577 WP_001006513.1.18845 WP_001006513.1.18862 WP_001006513.1.18916 WP_001006513.1.19126 WP_001006513.1.19128 WP_001006513.1.19428 WP_001006513.1.19442 WP_001006513.1.19503 WP_001006513.1.19597 WP_001006513.1.20107 WP_001006513.1.20379 WP_001006513.1.20404 WP_001006513.1.20602 WP_001006513.1.20669 WP_001006513.1.20699 WP_001006513.1.20758 WP_001006513.1.21073 WP_001006513.1.21179 WP_001006513.1.21279 WP_001006513.1.21281 WP_001006513.1.21558 WP_001006513.1.21671 WP_001006513.1.21717 WP_001006513.1.21764 WP_001006513.1.21815 WP_001006513.1.21866 WP_001006513.1.22521 WP_001006513.1.22773 WP_001006513.1.229 WP_001006513.1.2304 WP_001006513.1.23134 WP_001006513.1.2316 WP_001006513.1.23333 WP_001006513.1.23361 WP_001006513.1.2341 WP_001006513.1.23416 WP_001006513.1.23424 WP_001006513.1.23532 WP_001006513.1.23538 WP_001006513.1.2354 WP_001006513.1.23808 WP_001006513.1.23955 WP_001006513.1.240 WP_001006513.1.2401 WP_001006513.1.24280 WP_001006513.1.24345 WP_001006513.1.24399 WP_001006513.1.24980 WP_001006513.1.25386 WP_001006513.1.25649 WP_001006513.1.26020 WP_001006513.1.26156 WP_001006513.1.26223 WP_001006513.1.2627 WP_001006513.1.26326 WP_001006513.1.26508 WP_001006513.1.26580 WP_001006513.1.27186 WP_001006513.1.27435 WP_001006513.1.27458 WP_001006513.1.27639 WP_001006513.1.27863 WP_001006513.1.28431 WP_001006513.1.2849 WP_001006513.1.28508 WP_001006513.1.29095 WP_001006513.1.29708 WP_001006513.1.30045 WP_001006513.1.30107 WP_001006513.1.30292 WP_001006513.1.3032 WP_001006513.1.30360 WP_001006513.1.3054 WP_001006513.1.31096 WP_001006513.1.31853 WP_001006513.1.31964 WP_001006513.1.32111 WP_001006513.1.32264 WP_001006513.1.32271 WP_001006513.1.32814 WP_001006513.1.32942 WP_001006513.1.32955 WP_001006513.1.33625 WP_001006513.1.33811 WP_001006513.1.33819 WP_001006513.1.34108 WP_001006513.1.34133 WP_001006513.1.34195 WP_001006513.1.34261 WP_001006513.1.34634 WP_001006513.1.34643 WP_001006513.1.3514 WP_001006513.1.35201 WP_001006513.1.35266 WP_001006513.1.35630 WP_001006513.1.35880 WP_001006513.1.35881 WP_001006513.1.36322 WP_001006513.1.3635 WP_001006513.1.36354 WP_001006513.1.36364 WP_001006513.1.36513 WP_001006513.1.36668 WP_001006513.1.36686 WP_001006513.1.36874 WP_001006513.1.36956 WP_001006513.1.37054 WP_001006513.1.37260 WP_001006513.1.37262 WP_001006513.1.37537 WP_001006513.1.37676 WP_001006513.1.37784 WP_001006513.1.37999 WP_001006513.1.38420 WP_001006513.1.38590 WP_001006513.1.39208 WP_001006513.1.39514 WP_001006513.1.39675 WP_001006513.1.39853 WP_001006513.1.39933 WP_001006513.1.40039 WP_001006513.1.40152 WP_001006513.1.40346 WP_001006513.1.40433 WP_001006513.1.40459 WP_001006513.1.40470 WP_001006513.1.40484 WP_001006513.1.40491 WP_001006513.1.40542 WP_001006513.1.40571 WP_001006513.1.40740 WP_001006513.1.40782 WP_001006513.1.41538 WP_001006513.1.41573 WP_001006513.1.4175 WP_001006513.1.41883 WP_001006513.1.42128 WP_001006513.1.42152 WP_001006513.1.42498 WP_001006513.1.42617 WP_001006513.1.4272 WP_001006513.1.42783 WP_001006513.1.4284 WP_001006513.1.42853 WP_001006513.1.42865 WP_001006513.1.43103 WP_001006513.1.43222 WP_001006513.1.43335 WP_001006513.1.43407 WP_001006513.1.4365 WP_001006513.1.43884 WP_001006513.1.439 WP_001006513.1.44569 WP_001006513.1.44730 WP_001006513.1.45055 WP_001006513.1.45127 WP_001006513.1.45155 WP_001006513.1.45206 WP_001006513.1.45264 WP_001006513.1.45372 WP_001006513.1.45704 WP_001006513.1.45842 WP_001006513.1.45903 WP_001006513.1.45958 WP_001006513.1.46118 WP_001006513.1.46146 WP_001006513.1.46486 WP_001006513.1.46540 WP_001006513.1.4661 WP_001006513.1.47202 WP_001006513.1.4730 WP_001006513.1.4731 WP_001006513.1.47417 WP_001006513.1.47428 WP_001006513.1.47794 WP_001006513.1.47796 WP_001006513.1.47846 WP_001006513.1.47942 WP_001006513.1.48128 WP_001006513.1.48659 WP_001006513.1.48715 WP_001006513.1.48742 WP_001006513.1.488 WP_001006513.1.48874 WP_001006513.1.48927 WP_001006513.1.48984 WP_001006513.1.49238 WP_001006513.1.49317 WP_001006513.1.49593 WP_001006513.1.50277 WP_001006513.1.5028 WP_001006513.1.50577 WP_001006513.1.50625 WP_001006513.1.50813 WP_001006513.1.50822 WP_001006513.1.50980 WP_001006513.1.51160 WP_001006513.1.51163 WP_001006513.1.51177 WP_001006513.1.5201 WP_001006513.1.52391 WP_001006513.1.52676 WP_001006513.1.53085 WP_001006513.1.5320 WP_001006513.1.53214 WP_001006513.1.53823 WP_001006513.1.5397 WP_001006513.1.54191 WP_001006513.1.5425 WP_001006513.1.54398 WP_001006513.1.5450 WP_001006513.1.54706 WP_001006513.1.55092 WP_001006513.1.55208 WP_001006513.1.55929 WP_001006513.1.55932 WP_001006513.1.56429 WP_001006513.1.56785 WP_001006513.1.56807 WP_001006513.1.57098 WP_001006513.1.57148 WP_001006513.1.57300 WP_001006513.1.57518 WP_001006513.1.57546 WP_001006513.1.57678 WP_001006513.1.57751 WP_001006513.1.57945 WP_001006513.1.58295 WP_001006513.1.58596 WP_001006513.1.58844 WP_001006513.1.58975 WP_001006513.1.59010 WP_001006513.1.59194 WP_001006513.1.59378 WP_001006513.1.59394 WP_001006513.1.5943 WP_001006513.1.59554 WP_001006513.1.59633 WP_001006513.1.59741 WP_001006513.1.59916 WP_001006513.1.60216 WP_001006513.1.60386 WP_001006513.1.60633 WP_001006513.1.60694 WP_001006513.1.60955 WP_001006513.1.61169 WP_001006513.1.61523 WP_001006513.1.61753 WP_001006513.1.61869 WP_001006513.1.61875 WP_001006513.1.61935 WP_001006513.1.62165 WP_001006513.1.62324 WP_001006513.1.62425 WP_001006513.1.63347 WP_001006513.1.63546 WP_001006513.1.6366 WP_001006513.1.63723 WP_001006513.1.63749 WP_001006513.1.63911 WP_001006513.1.64201 WP_001006513.1.64253 WP_001006513.1.64315 WP_001006513.1.64382 WP_001006513.1.64441 WP_001006513.1.6455 WP_001006513.1.65007 WP_001006513.1.65051 WP_001006513.1.65086 WP_001006513.1.65469 WP_001006513.1.65528 WP_001006513.1.66329 WP_001006513.1.66633 WP_001006513.1.66696 WP_001006513.1.67839 WP_001006513.1.68424 WP_001006513.1.68506 WP_001006513.1.68723 WP_001006513.1.68925 WP_001006513.1.69049 WP_001006513.1.69157 WP_001006513.1.69843 WP_001006513.1.69857 WP_001006513.1.69943 WP_001006513.1.70069 WP_001006513.1.70176 WP_001006513.1.70247 WP_001006513.1.7049 WP_001006513.1.70775 WP_001006513.1.70813 WP_001006513.1.70892 WP_001006513.1.71129 WP_001006513.1.72106 WP_001006513.1.72326 WP_001006513.1.72361 WP_001006513.1.72369 WP_001006513.1.7238 WP_001006513.1.72480 WP_001006513.1.72964 WP_001006513.1.73148 WP_001006513.1.73429 WP_001006513.1.73555 WP_001006513.1.73855 WP_001006513.1.73929 WP_001006513.1.74111 WP_001006513.1.74503 WP_001006513.1.74666 WP_001006513.1.74991 WP_001006513.1.75012 WP_001006513.1.75326 WP_001006513.1.75378 WP_001006513.1.755 WP_001006513.1.75778 WP_001006513.1.75796 WP_001006513.1.76271 WP_001006513.1.76425 WP_001006513.1.76486 WP_001006513.1.7654 WP_001006513.1.76645 WP_001006513.1.77029 WP_001006513.1.7717 WP_001006513.1.77355 WP_001006513.1.77397 WP_001006513.1.77445 WP_001006513.1.77703 WP_001006513.1.77794 WP_001006513.1.77830 WP_001006513.1.77914 WP_001006513.1.78157 WP_001006513.1.78428 WP_001006513.1.78531 WP_001006513.1.79044 WP_001006513.1.79943 WP_001006513.1.80024 WP_001006513.1.8023 WP_001006513.1.80339 WP_001006513.1.80500 WP_001006513.1.80618 WP_001006513.1.80628 WP_001006513.1.80702 WP_001006513.1.80744 WP_001006513.1.80808 WP_001006513.1.8117 WP_001006513.1.81871 WP_001006513.1.81872 WP_001006513.1.81917 WP_001006513.1.82030 WP_001006513.1.82119 WP_001006513.1.82193 WP_001006513.1.82248 WP_001006513.1.82262 WP_001006513.1.82413 WP_001006513.1.82583 WP_001006513.1.83040 WP_001006513.1.83073 WP_001006513.1.83082 WP_001006513.1.83109 WP_001006513.1.83703 WP_001006513.1.83761 WP_001006513.1.84385 WP_001006513.1.84519 WP_001006513.1.84610 WP_001006513.1.8480 WP_001006513.1.85007 WP_001006513.1.85086 WP_001006513.1.85388 WP_001006513.1.85498 WP_001006513.1.85822 WP_001006513.1.85878 WP_001006513.1.85961 WP_001006513.1.85972 WP_001006513.1.85998 WP_001006513.1.86057 WP_001006513.1.86192 WP_001006513.1.86269 WP_001006513.1.86874 WP_001006513.1.86879 WP_001006513.1.87274 WP_001006513.1.87286 WP_001006513.1.87335 WP_001006513.1.87355 WP_001006513.1.87573 WP_001006513.1.87602 WP_001006513.1.87625 WP_001006513.1.87804 WP_001006513.1.88057 WP_001006513.1.88230 WP_001006513.1.88283 WP_001006513.1.88556 WP_001006513.1.8867 WP_001006513.1.89441 WP_001006513.1.89447 WP_001006513.1.89719 WP_001006513.1.89822 WP_001006513.1.89889 WP_001006513.1.8997 WP_001006513.1.89995 WP_001006513.1.90133 WP_001006513.1.90227 WP_001006513.1.90437 WP_001006513.1.90675 WP_001006513.1.90774 WP_001006513.1.90889 WP_001006513.1.91247 WP_001006513.1.91262 WP_001006513.1.91274 WP_001006513.1.91539 WP_001006513.1.91747 WP_001006513.1.91794 WP_001006513.1.91841 WP_001006513.1.92022 WP_001006513.1.92038 WP_001006513.1.92063 WP_001006513.1.92157 WP_001006513.1.92401 WP_001006513.1.92412 WP_001006513.1.92516 WP_001006513.1.92632 WP_001006513.1.92696 WP_001006513.1.92703 WP_001006513.1.92952 WP_001006513.1.92993 WP_001006513.1.93060 WP_001006513.1.93399 WP_001006513.1.93441 WP_001006513.1.93836 WP_001006513.1.93945 WP_001006513.1.94255 WP_001006513.1.94426 WP_001006513.1.94441 WP_001006513.1.94481 WP_001006513.1.94827 WP_001006513.1.95516 WP_001006513.1.95549 WP_001006513.1.9561 WP_001006513.1.95662 WP_001006513.1.95733 WP_001006513.1.95976 WP_001006513.1.96001 WP_001006513.1.9607 WP_001006513.1.96089 WP_001006513.1.96187 WP_001006513.1.96311 WP_001006513.1.96471 WP_001006513.1.9660 WP_001006513.1.96687 WP_001006513.1.96693 WP_001006513.1.96980 WP_001006513.1.97100 WP_001006513.1.97144 WP_001006513.1.97516 WP_001006513.1.97552 WP_001006513.1.97562 WP_001006513.1.97650 WP_001006513.1.97799 WP_001006513.1.97832 WP_001006513.1.9787 WP_001006513.1.98021 WP_001006513.1.98116 WP_001006513.1.98172 WP_001006513.1.98280 WP_001006513.1.98373 WP_001006513.1.98624 WP_001006513.1.98642 WP_001006513.1.99128 WP_001006513.1.99417 WP_001006513.1.99452 WP_001006513.1.995 WP_001006513.1.99861 WP_001006513.1.99872 WP_001006513.1.99949 WP_001006513.1.99992 243277.VCA0103 345073.VC0395_0036 579112.VCM66_A0101 593588.VCD_000141 gi|147671884|ref|YP_001214877.1| gi|229605201|ref|YP_002875905.1| gi|15600874|ref|NP_232504.1| gi|227811729|ref|YP_002811739.1| gi|147671884|ref|YP_001214877.1| GO.8841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]