SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8844 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8844
Domain Number 1 Region: 446-558
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.8844
Sequence length 560
Comment $ NYCOMPS $ SQ227488 $ PDBT340365 $
Sequence
MIPTMTSAGWAPGVVQFREYQRRWLRGDVLAGLTVAAYLIPQAMAYATVAGLPPAAGLWA
SIAPLAIYALLGSSRQLSIGPESATALMTAAVLAPMAAGDLRRYAVLAATLGLLVGLICL
LAGTARLGFLASLRSRPVLVGYMAGIALVMISSQLGTITGTSVEGNEFFSEVHSFATSVT
RVHWPTFVLAMSVLALLTMLTRWAPRAPGPIIAVLAATMLVAVMSLDAKGIAIVGRIPSG
LPTPGVPPVSVEDLRALIIPAAGIAIVTFTDGVLTARAFAARRGQEVNANAELRAVGACN
IAAGLTHGFPVSSSSSRTALADVVGGRTQLYSLIALGLVVIVMVFASGLLAMFPIAALGA
LVVYAALRLIDLSEFRRLARFRRSELMLALATTAAVLGLGVFYGVLAAVALSILELLRRV
AHPHDSVLGFVPGIAGMHDIDDYPQAKRVPGLVVYRYDAPLCFANAEDFRRRALTVVDQD
PGQVEWFVLNAESNVEVDLTALDALDQLRTELLRRGIVFAMARVKQDLRESLRAASLLDK
IGEDHIFMTLPTAVQAFRRR
Download sequence
Identical sequences A0A0T9MZE8 A5U399 I6X278 P9WGF7
GO.8844 419947.MRA_1750 83332.Rv1739c NP_216255.1.84033 WP_003916850.1.11596 WP_003916850.1.11960 WP_003916850.1.16108 WP_003916850.1.28202 WP_003916850.1.30888 WP_003916850.1.34255 WP_003916850.1.39239 WP_003916850.1.47207 WP_003916850.1.48419 WP_003916850.1.53230 WP_003916850.1.59961 WP_003916850.1.62021 WP_003916850.1.71329 WP_003916850.1.75665 WP_003916850.1.78322 WP_003916850.1.83470 WP_003916850.1.84488 WP_003916850.1.85823 WP_003916850.1.91207 WP_003916850.1.9139 WP_003916850.1.93245 WP_003916850.1.9368 gi|15608877|ref|NP_216255.1| gi|15608877|ref|NP_216255.1| gi|148661538|ref|YP_001283061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]