SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8846 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8846
Domain Number 1 Region: 396-478
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.8846
Sequence length 486
Comment $ NYCOMPS $ SQ178989 $ PDBT340367 $
Sequence
MNIQQLKNEWFGNVRGDVLAGIVVALALIPEAIAFSIIAGVDPMVGLYASFCIAVVIAFV
GGRPGMISAATGAMALLMINLVADHGLHYLLAATILTGVLQILFGVFKLASVMKFVPRSV
MIGFVNALAILIFTSQLQHFVGETWVMYALVALTLAIIYLLPKVTTAVPSTLVAIIIVTA
IVIFGNIGVRTVGDLGTLTQSLPTFLIPSVPFSFETLMIIFPYSLALAIVGLLESLLTAN
IVDDMTDTESDKNKESRGQGIANIVTGFFGGMAGCAMIGQSVINVKSGGRGRLSALVAGV
FLMFLIIVLGNVVVQIPMAALAGVMIMVSIGTFDWSSLRNLHKIPRTDATVMVVTVGTVV
YTHDLSKGVLAGVVLSAIFFAAKISRVKVEEMTSATPELKRYKVQGQLFFASVSDLPAKF
SYMANVNEVEIDLSEAHVWDDSAVGALDKIEMKFEQQNIKVTFTGLNTESRKLVQRMGGL
SKASGH
Download sequence
Identical sequences A0A0M0KDP4 Q9KFR3
272558.BH0414 gi|15612977|ref|NP_241280.1| WP_010896592.1.28103 WP_010896592.1.91347 APC64589 GO.8846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]