SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8867 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8867
Domain Number 1 Region: 349-452
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.18e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.8867
Sequence length 460
Comment $ NYCOMPS $ SQ227507 $ PDBT340388 $
Sequence
MAAILISLIGKYGMNGIFIATFMAGIFLLLAGIFRLGNLISLIPSPVITGFTSGIAIIIA
SGQIKNFFGIEHFTGSFFDLMKFISGLHIDYPSTIIGLLTILLMIFYPKSWGKKFPASLL
AILLSTLAVLALKLDIPLVGKIPTTLIPQAHLRLTELNPQDMKTLLIPAISITVLGMTES
LLCGASAGRATNHPMDNNQELVAQGIGNIFIPFFGGIPATAAIARTSVAIKAGAQTRLTG
IIHALILLLSMFLFAPFMTHIPLSALAGVLIMTAVRMNEWEAIRFLFKNKLKSGIIEFFV
TMIITVIFDLSTAILAGIVVGFLLFIVKISQIEINSSQIEPERISQNHHEVFTDWTVIYI
SGPLFFLNSSKLKQAIDELPANTNAVLSLRGVPMIDVTSIKLLIDIYSIFHKEERQIVFA
SMNPKLKESFKRTGLISMVGEEAIYPSVNEFLLDLVDKNK
Download sequence
Identical sequences Q9CJE5
GO.8867 gi|15672032|ref|NP_266206.1| NP_266206.1.16647 272623.L1004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]