SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8901 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8901
Domain Number 1 Region: 395-476
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000353
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.8901
Sequence length 478
Comment $ NYCOMPS $ SQ173008 $ PDBT340422 $
Sequence
MNNSFTLKQQWFGNIRKDILAGILVALALIPEAIGFSIIAGVDPMVGLYASFCIAIIISI
FGGRPGMISAATGSMAVVMVSLVADHGLQYLFAATILTGIIQVILGISKIARLMKFIPRS
VMIGFVNALAILIFSAQLPQFEGASWSMYAMLAGSLVIIYVLPRFTTAVPSPLVAIIVMT
IIAVTFHVDVRTVGDMGNISSSLPHFLIPDVPFTFETLQIIFPYSIALAFVGLLESLLTA
QIIDEMTDTDSDKNKESRGQGIANIVTGFFGGMAGCAMIGQSVINTKAGGRGRLSAFVAG
AFLMFLIAVLSHVVVKIPMAALVAVMVMVSVGTFDWSSLKGLKKAPLTDSIVMVVTVVTV
VVTDDLSKGVFVGVLLSAVFFVAKISKLKIVSHAEDQKLRTYQVKGQIFFASVTDLTNAF
IYQEDIERVVIDLTEAHVWDDSGAAALDKIVAKFKEQGIEAELKGLNKASKSLMKQMA
Download sequence
Identical sequences A0A164W824 A0A1B2ASX6 G4F0P2 P55189
gi|16077226|ref|NP_388039.1| 224308.BSU01580 NP_388039.1.22788 WP_003234986.1.11257 WP_003234986.1.1140 WP_003234986.1.12759 WP_003234986.1.15902 WP_003234986.1.16291 WP_003234986.1.19261 WP_003234986.1.23108 WP_003234986.1.2546 WP_003234986.1.25531 WP_003234986.1.27372 WP_003234986.1.27660 WP_003234986.1.2914 WP_003234986.1.32025 WP_003234986.1.32219 WP_003234986.1.32420 WP_003234986.1.32693 WP_003234986.1.33846 WP_003234986.1.36189 WP_003234986.1.40859 WP_003234986.1.44140 WP_003234986.1.44184 WP_003234986.1.45019 WP_003234986.1.47157 WP_003234986.1.54596 WP_003234986.1.56274 WP_003234986.1.56411 WP_003234986.1.57184 WP_003234986.1.57201 WP_003234986.1.5726 WP_003234986.1.57513 WP_003234986.1.6139 WP_003234986.1.64889 WP_003234986.1.6517 WP_003234986.1.65223 WP_003234986.1.72999 WP_003234986.1.76977 WP_003234986.1.78686 WP_003234986.1.78811 WP_003234986.1.81116 WP_003234986.1.81747 WP_003234986.1.88042 WP_003234986.1.89821 WP_003234986.1.91723 WP_003234986.1.93420 WP_003234986.1.94199 WP_003234986.1.95009 WP_003234986.1.96043 WP_003234986.1.979 gi|470160310|ref|YP_007532085.1| gi|560127185|ref|YP_008828326.1| APC62041 GO.8901 gi|402774401|ref|YP_006628345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]