SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8909 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8909
Domain Number 1 Region: 426-525
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.18e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.8909
Sequence length 530
Comment $ NYCOMPS $ SQ227544 $ PDBT340430 $
Sequence
MRFSGRFKGYNLQKFQKDLIAGIVVGVVAIPLGMAFAIASGVEPEYGLYTVVIAGICISL
FGGSKYQIGGPTGAFVPILFGIIMQYGLENLLIAGFMAGVMLVLFGLFKLGKIMKFVPKP
VIVGFTAGIAVLIFTEQIANFLGLRNVEKHENFHHNMFEIVQQLGTFNVYAILTAVIGLV
ILLVSAKVMPKVPGALLALLISTVVAVVFFPDRMATIGSTYGEIPRHLPEFQFPELTLDK
MVMLFPAALVIALLGGLESILSAMVADNMKGSKHDSNKELVGQGIANMAAPLFGGIPATG
AIARTATNIKNGAVSPVSGVVHGVVVLLVLLVFAPYASHVPLASMAPILMVVAWNMSERK
EVANMLRLKNADSFILAATFALTVLFDLIIGVATGLLLAFVFFIRRMSEATRIHNQETHP
VLAKREDPSVSMYAIEGPLFFGSIDSLESSLLEHVQKKPKTLILLMNKVHYMDTSAEAVL
GNIMNRIKRHNGKLMIVGLQSQPKELLHKTGLFHKIGKQHFFDHHDEITG
Download sequence
Identical sequences A0A162QPG5 A0A1D8FMC5 L8AVD9 O06984
gi|470163683|ref|YP_007535458.1| gi|321313016|ref|YP_004205303.1| gi|560130470|ref|YP_008831611.1| GO.8909 NP_391346.1.22788 WP_003244488.1.11257 WP_003244488.1.1140 WP_003244488.1.11581 WP_003244488.1.12759 WP_003244488.1.15902 WP_003244488.1.16291 WP_003244488.1.19261 WP_003244488.1.25531 WP_003244488.1.27372 WP_003244488.1.27660 WP_003244488.1.2914 WP_003244488.1.32219 WP_003244488.1.32420 WP_003244488.1.33846 WP_003244488.1.36189 WP_003244488.1.39605 WP_003244488.1.40859 WP_003244488.1.44140 WP_003244488.1.44184 WP_003244488.1.45019 WP_003244488.1.47157 WP_003244488.1.56274 WP_003244488.1.56411 WP_003244488.1.57201 WP_003244488.1.5726 WP_003244488.1.57513 WP_003244488.1.6139 WP_003244488.1.6517 WP_003244488.1.65223 WP_003244488.1.72999 WP_003244488.1.74782 WP_003244488.1.76977 WP_003244488.1.78686 WP_003244488.1.81116 WP_003244488.1.81747 WP_003244488.1.82722 WP_003244488.1.84556 WP_003244488.1.88042 WP_003244488.1.91723 WP_003244488.1.93073 WP_003244488.1.93420 WP_003244488.1.94199 WP_003244488.1.96043 WP_003244488.1.97264 WP_003244488.1.979 gi|402777629|ref|YP_006631573.1| 224308.BSU34660 gi|16080519|ref|NP_391346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]