SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8925 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8925
Domain Number 1 Region: 442-544
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.029
Further Details:      
 
Weak hits

Sequence:  GO.8925
Domain Number - Region: 82-409
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00523
Family LacY-like proton/sugar symporter 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.8925
Sequence length 566
Comment $ NYCOMPS $ SQ227550 $ PDBT340446 $
Sequence
MIKQIFPIFQWLPNYHPSWLKADVVAGLTLAAYAIPVALAYGSLAGLPSEVGLYCYMLGA
VGYAFFGTSRQLALGPTSAISILVGVSLAPLANDDAGRYLILASSTAILVAIICLLAWLL
KLSQIVNFISEPILTGFKAGAALQIASTQLPKLFGVPSGGSNFFSRIWDLFHHWQEIQPA
TLLVGGLALVLLVMGDRLWPSKPISLMVVILAIVVMGITNLLEQGVKVVGEIPQGLPSFG
MPHWSFSDLDSLLPLALACFLLSYIEGISTARSFAIKHHYRINPEQELLAIGAANLAAGL
GQGYPIAGGLSQSAVNEKAGAKTPLAIIITACIIAIVLLFFTGLFSNLPEAILGSVVLVA
VKGLINIPELQHLKKIAPLEFKVSLIALFGVLCFGVLQGVLLAAIASILFLIHIISYPSS
AVLGRIPGSDQFSDLERHPENLVISGVLIYRINGPILYFNINNIESDLFNHLAQQQEPVE
LVIFEMGTSPGIDTPAARWFKTLSQSLNQQGITLKLVNASGFVRDRLRAEGLEGEVGTFR
RLDTVDSLISEFNCQRYSDLPHTEND
Download sequence
Identical sequences L8AGJ4 P72770
WP_010871415.1.11876 WP_010871415.1.1889 WP_010871415.1.18904 WP_010871415.1.33690 WP_010871415.1.35395 WP_010871415.1.47586 WP_010871415.1.99424 gi|383321118|ref|YP_005381971.1| gi|16329377|ref|NP_440105.1| gi|383324288|ref|YP_005385141.1| GO.8925 gi|16329377|ref|NP_440105.1| gi|383490172|ref|YP_005407848.1| 1148.slr1776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]