SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8937 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8937
Domain Number 1 Region: 425-536
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.81e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.8937
Sequence length 544
Comment $ NYCOMPS $ SQ227558 $ PDBT340458 $
Sequence
MKKVLSNSVKGYTWARFRKDLLAGIIVGIIALPLGMSFAIASGVKPEYGIYSSFVAGIIV
SIFGGSRFQIAGPTGAFIPVLLGIVLTYGYQDLLVAGMMAGVLLCLMGIFKLGTLIKFIP
RPVTIGFTAGIAVTIFMGQVGNFLGLTGMEKHESFIANMKEIWLHLDSWNFYSVLISCIC
MFVLFVFPKILPRIPAPLIGLVITTGIAMLFFKDALPTIGSAYGEIPSTFPPFQFPDMTF
ANMSKLIGPAFVIAMLGGIESLLSAVVADGMTNTKHNSNRELIGQGIANIVTPMFGGIPA
TGAIARTATNINNGATSRVSGVIHGIFVLLTLLVLAPVAINIPIAAMAPILMLVAWNMSE
RKTFQHIIKLKSGDTLVLVITFLLTVFASLTVAVEVGLLLAVVLFAKQMGSSMQIEEIEP
EGAEIAPHLHDKISIFTIRGPLFFGAAQIFQQNIIKAIHVKPEFLILRMGKVPIIDATAE
GYFHQIEKEFSKQGGQILITGLTDKAKESLKGSGLYDRIGEEHFFLHTEDAVHYAENALS
ELSR
Download sequence
Identical sequences H1GC31 Q92DB9
272626.lin0896 GO.8937 WP_003771135.1.46653 WP_003771135.1.51650 WP_003771135.1.99521 WP_003771135.1.99921 gi|16799969|ref|NP_470237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]