SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8942 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8942
Domain Number 1 Region: 426-536
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.3e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.8942
Sequence length 541
Comment $ NYCOMPS $ SQ227563 $ PDBT340463 $
Sequence
MKKVLLNSVKGYTWARFRKDLLAGIIVGIIALPLAMSFAIASGVSPEYGIYSSFVAGIIV
SIFGGSKFQIAGPTGAFIPVLLGIVLTYGYQDLLVAGMMAGVLLCLMGIFKIGTLIKFIP
RPVTIGFTAGIAVTIFMGQVGNFLGLTGMEKHESFVANMKEIWLHLDSWNFYSVLISCIC
MLVLFIFPKILPRIPAPLIGLVVTTAIAMLFFPDALPTIGSAYGNIPSTFPPFEFPDMTF
ANMSKLIGPAFVIAMLGGIESLLSAVVADGMTNTKHNSNRELIGQGIANIVTPMFGGIPA
TGAIARTATNINNGATSRVSGVIHGVFVLLTLLVLAPVAVNIPIAAMAPILMLVAWNMSE
RKTFQHIIKLKSGDTLVLVITFLLTVFASLTVAVEVGLLLAVVLFAKQMGSSMQIEEIEP
EGAEIAPHLHEKISIFTIRGPLFFGAAQIFQQNIIKAIHVKPKYLILRMGKVPIIDATAE
GYFHQIEKEFSKQGGQILITGLTDKAKESLKGSGLYDRIGEEHFFSHTEDAIHYAENALN
K
Download sequence
Identical sequences A0A0H3GEW6 A0A1D2IXA8 A0A2G8PRQ2 A0A2G8Q821 A0A2G8QHZ3 A0A2G8QXW2 Q8Y8K4
gi|470209773|ref|YP_007606347.1| gi|16802938|ref|NP_464423.1| GO.8942 gi|470206641|ref|YP_007603216.1| 169963.lmo0897 gi|386049825|ref|YP_005967816.1| gi|386043222|ref|YP_005962027.1| gi|404410137|ref|YP_006695725.1| gi|405757895|ref|YP_006687171.1| gi|404283339|ref|YP_006684236.1| gi|284801227|ref|YP_003413092.1| NP_464423.1.42710 WP_003732387.1.100112 WP_003732387.1.100510 WP_003732387.1.100530 WP_003732387.1.10112 WP_003732387.1.101144 WP_003732387.1.101184 WP_003732387.1.101252 WP_003732387.1.101752 WP_003732387.1.10198 WP_003732387.1.10420 WP_003732387.1.10484 WP_003732387.1.11177 WP_003732387.1.1123 WP_003732387.1.11266 WP_003732387.1.11313 WP_003732387.1.11686 WP_003732387.1.11712 WP_003732387.1.11779 WP_003732387.1.11851 WP_003732387.1.11973 WP_003732387.1.12037 WP_003732387.1.12143 WP_003732387.1.12824 WP_003732387.1.13052 WP_003732387.1.13105 WP_003732387.1.13134 WP_003732387.1.13160 WP_003732387.1.13304 WP_003732387.1.1336 WP_003732387.1.13428 WP_003732387.1.13695 WP_003732387.1.1556 WP_003732387.1.15816 WP_003732387.1.16207 WP_003732387.1.16499 WP_003732387.1.1657 WP_003732387.1.17228 WP_003732387.1.17352 WP_003732387.1.1764 WP_003732387.1.17644 WP_003732387.1.17695 WP_003732387.1.178 WP_003732387.1.1794 WP_003732387.1.18222 WP_003732387.1.18576 WP_003732387.1.18648 WP_003732387.1.19080 WP_003732387.1.19189 WP_003732387.1.19409 WP_003732387.1.1947 WP_003732387.1.21133 WP_003732387.1.21705 WP_003732387.1.21995 WP_003732387.1.22154 WP_003732387.1.22190 WP_003732387.1.22202 WP_003732387.1.22434 WP_003732387.1.22962 WP_003732387.1.23193 WP_003732387.1.23254 WP_003732387.1.23582 WP_003732387.1.24349 WP_003732387.1.24370 WP_003732387.1.24546 WP_003732387.1.24972 WP_003732387.1.25020 WP_003732387.1.25401 WP_003732387.1.26052 WP_003732387.1.26060 WP_003732387.1.26139 WP_003732387.1.26145 WP_003732387.1.26350 WP_003732387.1.26406 WP_003732387.1.26523 WP_003732387.1.26632 WP_003732387.1.26891 WP_003732387.1.27281 WP_003732387.1.27839 WP_003732387.1.28042 WP_003732387.1.28123 WP_003732387.1.28297 WP_003732387.1.28325 WP_003732387.1.28402 WP_003732387.1.28747 WP_003732387.1.28803 WP_003732387.1.2920 WP_003732387.1.29705 WP_003732387.1.29723 WP_003732387.1.29738 WP_003732387.1.29762 WP_003732387.1.30193 WP_003732387.1.30227 WP_003732387.1.30267 WP_003732387.1.305 WP_003732387.1.30827 WP_003732387.1.30882 WP_003732387.1.30902 WP_003732387.1.31108 WP_003732387.1.31444 WP_003732387.1.31584 WP_003732387.1.31830 WP_003732387.1.32209 WP_003732387.1.32210 WP_003732387.1.32402 WP_003732387.1.32622 WP_003732387.1.3324 WP_003732387.1.33336 WP_003732387.1.33688 WP_003732387.1.337 WP_003732387.1.33875 WP_003732387.1.33995 WP_003732387.1.34326 WP_003732387.1.34851 WP_003732387.1.35135 WP_003732387.1.35450 WP_003732387.1.36181 WP_003732387.1.36203 WP_003732387.1.36241 WP_003732387.1.364 WP_003732387.1.36936 WP_003732387.1.37561 WP_003732387.1.37882 WP_003732387.1.38076 WP_003732387.1.38150 WP_003732387.1.38733 WP_003732387.1.38792 WP_003732387.1.38800 WP_003732387.1.38833 WP_003732387.1.3919 WP_003732387.1.39262 WP_003732387.1.39351 WP_003732387.1.3959 WP_003732387.1.39630 WP_003732387.1.39887 WP_003732387.1.40124 WP_003732387.1.40263 WP_003732387.1.40820 WP_003732387.1.40953 WP_003732387.1.40976 WP_003732387.1.41281 WP_003732387.1.41903 WP_003732387.1.41909 WP_003732387.1.42127 WP_003732387.1.4218 WP_003732387.1.42672 WP_003732387.1.43267 WP_003732387.1.43327 WP_003732387.1.43619 WP_003732387.1.4371 WP_003732387.1.44023 WP_003732387.1.44645 WP_003732387.1.4479 WP_003732387.1.44897 WP_003732387.1.44924 WP_003732387.1.45295 WP_003732387.1.45309 WP_003732387.1.45524 WP_003732387.1.45708 WP_003732387.1.45811 WP_003732387.1.45877 WP_003732387.1.45983 WP_003732387.1.45994 WP_003732387.1.4604 WP_003732387.1.46045 WP_003732387.1.4615 WP_003732387.1.46314 WP_003732387.1.46863 WP_003732387.1.46883 WP_003732387.1.47055 WP_003732387.1.47412 WP_003732387.1.47593 WP_003732387.1.4766 WP_003732387.1.47738 WP_003732387.1.47953 WP_003732387.1.48180 WP_003732387.1.48358 WP_003732387.1.48471 WP_003732387.1.48572 WP_003732387.1.48624 WP_003732387.1.48661 WP_003732387.1.48999 WP_003732387.1.49146 WP_003732387.1.49202 WP_003732387.1.49415 WP_003732387.1.49467 WP_003732387.1.49604 WP_003732387.1.49668 WP_003732387.1.49952 WP_003732387.1.49962 WP_003732387.1.5020 WP_003732387.1.50236 WP_003732387.1.50237 WP_003732387.1.50243 WP_003732387.1.50334 WP_003732387.1.50883 WP_003732387.1.50898 WP_003732387.1.50926 WP_003732387.1.50971 WP_003732387.1.5129 WP_003732387.1.51318 WP_003732387.1.51435 WP_003732387.1.51510 WP_003732387.1.51720 WP_003732387.1.51732 WP_003732387.1.52447 WP_003732387.1.52684 WP_003732387.1.52867 WP_003732387.1.53266 WP_003732387.1.53378 WP_003732387.1.53807 WP_003732387.1.53920 WP_003732387.1.54046 WP_003732387.1.54155 WP_003732387.1.54160 WP_003732387.1.54181 WP_003732387.1.54564 WP_003732387.1.54639 WP_003732387.1.55231 WP_003732387.1.55238 WP_003732387.1.55487 WP_003732387.1.55683 WP_003732387.1.55740 WP_003732387.1.55824 WP_003732387.1.55847 WP_003732387.1.55890 WP_003732387.1.5601 WP_003732387.1.56526 WP_003732387.1.56759 WP_003732387.1.56923 WP_003732387.1.57132 WP_003732387.1.57404 WP_003732387.1.57547 WP_003732387.1.57578 WP_003732387.1.57625 WP_003732387.1.57766 WP_003732387.1.57948 WP_003732387.1.57963 WP_003732387.1.57979 WP_003732387.1.58030 WP_003732387.1.58069 WP_003732387.1.58177 WP_003732387.1.58661 WP_003732387.1.58828 WP_003732387.1.59045 WP_003732387.1.59343 WP_003732387.1.59571 WP_003732387.1.5973 WP_003732387.1.59799 WP_003732387.1.59937 WP_003732387.1.59949 WP_003732387.1.59984 WP_003732387.1.60166 WP_003732387.1.60219 WP_003732387.1.60258 WP_003732387.1.60369 WP_003732387.1.60956 WP_003732387.1.61002 WP_003732387.1.61109 WP_003732387.1.61244 WP_003732387.1.62177 WP_003732387.1.62430 WP_003732387.1.62629 WP_003732387.1.62655 WP_003732387.1.62663 WP_003732387.1.62852 WP_003732387.1.62904 WP_003732387.1.63359 WP_003732387.1.63676 WP_003732387.1.6397 WP_003732387.1.64041 WP_003732387.1.64200 WP_003732387.1.64227 WP_003732387.1.64259 WP_003732387.1.6460 WP_003732387.1.648 WP_003732387.1.65309 WP_003732387.1.65730 WP_003732387.1.6579 WP_003732387.1.65913 WP_003732387.1.66005 WP_003732387.1.66039 WP_003732387.1.66184 WP_003732387.1.66311 WP_003732387.1.66338 WP_003732387.1.66512 WP_003732387.1.6672 WP_003732387.1.66884 WP_003732387.1.67301 WP_003732387.1.6731 WP_003732387.1.67352 WP_003732387.1.67408 WP_003732387.1.67610 WP_003732387.1.67668 WP_003732387.1.67694 WP_003732387.1.67709 WP_003732387.1.67795 WP_003732387.1.67884 WP_003732387.1.68112 WP_003732387.1.68123 WP_003732387.1.68197 WP_003732387.1.68414 WP_003732387.1.68528 WP_003732387.1.69190 WP_003732387.1.69471 WP_003732387.1.69570 WP_003732387.1.69631 WP_003732387.1.70309 WP_003732387.1.7051 WP_003732387.1.70588 WP_003732387.1.70690 WP_003732387.1.70992 WP_003732387.1.71468 WP_003732387.1.71753 WP_003732387.1.71921 WP_003732387.1.72051 WP_003732387.1.72057 WP_003732387.1.7218 WP_003732387.1.72228 WP_003732387.1.72467 WP_003732387.1.72566 WP_003732387.1.72636 WP_003732387.1.734 WP_003732387.1.74217 WP_003732387.1.74290 WP_003732387.1.74351 WP_003732387.1.74450 WP_003732387.1.74572 WP_003732387.1.74754 WP_003732387.1.74837 WP_003732387.1.75069 WP_003732387.1.75240 WP_003732387.1.75604 WP_003732387.1.75670 WP_003732387.1.76124 WP_003732387.1.76769 WP_003732387.1.77116 WP_003732387.1.77149 WP_003732387.1.77246 WP_003732387.1.77350 WP_003732387.1.7736 WP_003732387.1.77420 WP_003732387.1.77681 WP_003732387.1.77823 WP_003732387.1.78121 WP_003732387.1.78167 WP_003732387.1.78203 WP_003732387.1.7832 WP_003732387.1.78336 WP_003732387.1.78525 WP_003732387.1.79184 WP_003732387.1.79212 WP_003732387.1.7932 WP_003732387.1.79630 WP_003732387.1.79803 WP_003732387.1.79964 WP_003732387.1.80028 WP_003732387.1.80036 WP_003732387.1.80105 WP_003732387.1.80790 WP_003732387.1.81261 WP_003732387.1.81503 WP_003732387.1.81662 WP_003732387.1.82440 WP_003732387.1.82719 WP_003732387.1.82893 WP_003732387.1.82951 WP_003732387.1.83030 WP_003732387.1.83137 WP_003732387.1.83215 WP_003732387.1.83260 WP_003732387.1.83323 WP_003732387.1.83478 WP_003732387.1.83546 WP_003732387.1.83932 WP_003732387.1.8418 WP_003732387.1.84265 WP_003732387.1.84320 WP_003732387.1.84367 WP_003732387.1.84539 WP_003732387.1.84586 WP_003732387.1.84588 WP_003732387.1.8460 WP_003732387.1.84833 WP_003732387.1.84980 WP_003732387.1.85037 WP_003732387.1.85203 WP_003732387.1.8593 WP_003732387.1.86308 WP_003732387.1.86484 WP_003732387.1.86597 WP_003732387.1.87085 WP_003732387.1.87108 WP_003732387.1.87536 WP_003732387.1.87701 WP_003732387.1.8782 WP_003732387.1.87920 WP_003732387.1.88015 WP_003732387.1.88128 WP_003732387.1.88485 WP_003732387.1.88584 WP_003732387.1.88589 WP_003732387.1.88890 WP_003732387.1.89085 WP_003732387.1.89160 WP_003732387.1.89386 WP_003732387.1.89450 WP_003732387.1.8988 WP_003732387.1.90086 WP_003732387.1.9019 WP_003732387.1.90201 WP_003732387.1.90567 WP_003732387.1.90829 WP_003732387.1.9109 WP_003732387.1.91168 WP_003732387.1.91556 WP_003732387.1.91765 WP_003732387.1.92049 WP_003732387.1.92132 WP_003732387.1.92142 WP_003732387.1.92148 WP_003732387.1.92274 WP_003732387.1.92370 WP_003732387.1.92409 WP_003732387.1.92548 WP_003732387.1.92595 WP_003732387.1.93556 WP_003732387.1.93777 WP_003732387.1.93859 WP_003732387.1.93895 WP_003732387.1.93920 WP_003732387.1.93997 WP_003732387.1.94032 WP_003732387.1.94191 WP_003732387.1.94758 WP_003732387.1.94961 WP_003732387.1.95162 WP_003732387.1.95186 WP_003732387.1.95702 WP_003732387.1.95715 WP_003732387.1.95945 WP_003732387.1.96140 WP_003732387.1.96407 WP_003732387.1.9643 WP_003732387.1.96586 WP_003732387.1.9672 WP_003732387.1.96874 WP_003732387.1.96940 WP_003732387.1.97165 WP_003732387.1.97390 WP_003732387.1.97633 WP_003732387.1.97752 WP_003732387.1.97820 WP_003732387.1.98038 WP_003732387.1.98042 WP_003732387.1.98193 WP_003732387.1.98331 WP_003732387.1.98351 WP_003732387.1.9894 WP_003732387.1.99026 WP_003732387.1.99512 WP_003732387.1.99520 WP_003732387.1.99785 WP_003732387.1.99974 gi|550897070|ref|YP_008666566.1| gi|284994369|ref|YP_003416137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]