SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8956 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8956
Domain Number 1 Region: 401-485
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000471
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.8956
Sequence length 495
Comment $ NYCOMPS $ SQ227575 $ PDBT340477 $
Sequence
MSLLRAELAQWRASPARELMAGAVATFALIPEVIAFAFVAGVDPQVGLFASFVIGIVIAF
CGGRPAMISAAAGSVALVAAPLVAAHGLPYLLAAGWLAGVVQILFGVLRLGVLMRFVSSS
VRTGFVNALAVLIFAAQLPHLLGANPTTWVMLGAGLAIIYGLPRLRLPGLSAIPSPLLCI
LLLSVAGTALHLPLKTVADLGKLPNALPFLQWPAVPLTLETLRIIALPALAIAMVGLLES
MMTARVVDELTDTPSNKNRECTGLGIANAAASLFGGIAGCGMIGQTVGNVKYGGRGRLST
LFAGVFLLILMVLLKPWVSQVPVVALVAIMVMVSAETFDWRSLRTVVTHPRTSSVVMLAT
VAVTLFTHNLAAGVAVGVLLSGVFFTFKVAGLLQIAHHDGADGVRTYSVRGQVFFASADV
FIDAFDAREVPGRAVVIDVGRAHFWDITAVAALDKVVQRLRHHGLDVQVKGLNAGSRRLM
QRHALGEDALESALP
Download sequence
Identical sequences A0A0U5FBK5 A0A1T1S563 M4TS33 Q8PPS2
gi|21241384|ref|NP_640966.1| gi|470470547|ref|YP_007635115.1| WP_011050432.1.101581 WP_011050432.1.13318 WP_011050432.1.13350 WP_011050432.1.18336 WP_011050432.1.19505 WP_011050432.1.21004 WP_011050432.1.22109 WP_011050432.1.22678 WP_011050432.1.28779 WP_011050432.1.29860 WP_011050432.1.30380 WP_011050432.1.30778 WP_011050432.1.31392 WP_011050432.1.3308 WP_011050432.1.35047 WP_011050432.1.35540 WP_011050432.1.37228 WP_011050432.1.38217 WP_011050432.1.39696 WP_011050432.1.41216 WP_011050432.1.41431 WP_011050432.1.42745 WP_011050432.1.43799 WP_011050432.1.43832 WP_011050432.1.46272 WP_011050432.1.47697 WP_011050432.1.47707 WP_011050432.1.56391 WP_011050432.1.58382 WP_011050432.1.60328 WP_011050432.1.6260 WP_011050432.1.63386 WP_011050432.1.6829 WP_011050432.1.70026 WP_011050432.1.70193 WP_011050432.1.71126 WP_011050432.1.71284 WP_011050432.1.72810 WP_011050432.1.76206 WP_011050432.1.80602 WP_011050432.1.87455 WP_011050432.1.88516 WP_011050432.1.88706 WP_011050432.1.88988 WP_011050432.1.89206 WP_011050432.1.90138 WP_011050432.1.90200 WP_011050432.1.92041 WP_011050432.1.92912 WP_011050432.1.94705 WP_011050432.1.96706 WP_011050432.1.99816 GO.8956 190486.XAC0613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]