SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8963 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8963
Domain Number 1 Region: 447-555
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000451
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.8963
Sequence length 579
Comment $ NYCOMPS $ SQ227582 $ PDBT340484 $
Sequence
MSIKWARFVPGITAMRGYQRSWLKGDVIAGITVAAYLVPQVMAYAVIAGLPAVVGLWGVL
APMALYFFLGTSRNLSVGPESTTALMTAAGVGALVGAAGGPERYAEVAALLAIAVGIVCA
VGFIGRLGFLTRLLSRPVLVGYLIGIAVLMIVSQLSKVTQVNVESGQTWQEIISFIKVAG
QAHIPTVILAVVVLSLLYLANWLTPKFPSTLMVLLLSAAAVGFFHLDRFGLEVIGEVPRG
LPQPSIPSIGDLEIWSLLPYAVGIAIVGFSDNVLTARAFASGKDEVIDSNQELLALGTAN
LANGFFQGFPVSSSGSRTVLGDTAGARTQVHSLVVVALVIMVLLFAGPVLESFPDAALGA
LVIYAATQLIDIAEIKRIARFRKSELVITAATAASVVASGVLAGIGVAVTLSILDLIRRI
TRPYADVLGYTPGMAGMHSLEDYPESTAVEGLVVFRYDSPLFFANADDFSKRAIEAVDEA
TQPVHWFLLNAEANTEVDLTAVDAMEALRKTLEERGIRFAMARVKQDLRRSLEPAGFIES
VGEEYIFATLPTAVKGYSVEFRDRFGNYPEGVPKEILEL
Download sequence
Identical sequences A0A2H5HX17 Q8NRJ7
GO.8963 NP_600277.2.3765 WP_011014079.1.21641 WP_011014079.1.3871 WP_011014079.1.4395 WP_011014079.1.80527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]