SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8969 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8969
Domain Number 1 Region: 468-575
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000124
Family Anti-sigma factor antagonist SpoIIaa 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.8969
Sequence length 588
Comment $ NYCOMPS $ SQ227587 $ PDBT340490 $
Sequence
MDPHVSHSAHLFSLRIAHALNEACVKDRYSFKRFGQDLLAGLTVGIIAIPLAMALAIASG
VPPQYGLYTAIVGGFIIAMTGGSRYSVSGPTAAFVVLLYPIAQQFGLAGLLIATVMSGMM
LVAMAMLRLGRLILYIPESVTLGFTAGIGVVIATLQLKDFFGLQIEHMPEQYFAKLMALG
QALPSLHLPSLFIAAATLATMLLWPRLKIPVPAHLPAIALGSILALILNAMGAEIETIGT
RFHYQLTDGGIGSGIPAVLPHFEWPWLQTGPNGQAFEFNLAAFQALLPAAFAIAMLGAIE
SLLCAVVLDGMTGKRHSANSELLGQGIGNIIAPFFGGIPATAAIARSAANVKAGAQSPIA
SMIHALVVLIGLVALAGILAYLPMSAMAALLLVVAWNMSEAPKAVHLLKTAPTSDILVFL
SCFSLTVIFDMVIAISVGIILAALLFMKEIAEMTKLYDISSNKRYVDQSLPADWAVLKIN
GPLFFAAADRIFAEIASLTQDKQVIVLYLDGVSILDAGGLAALSKLIEKCKLNQTKLLIT
DLQFQPIRTLAKAKIQPVEGVLKFYPTLREALTEAPSPELEATPEATD
Download sequence
Identical sequences Q8EBG5
NP_719100.1.27637 GO.8969 gi|24375057|ref|NP_719100.1| 211586.SO_3553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]