SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8978 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8978
Domain Number 1 Region: 424-517
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.1e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.8978
Sequence length 521
Comment $ NYCOMPS $ SQ227595 $ PDBT340499 $
Sequence
MHRLSLLLPFLTWLPRQSGRSLRQDLLVGLSGAILALPQSIAYALIAGLPAEYGLYAAIV
PVLIACLWGSSWYLICGPTAAISIVLYASISPLAVAGSADYITLVLLLTFLGGIFQLLLG
LLRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGMALPSQATALMTVQDLASHAGEV
DLPSLLLGLATVVIGAAFKLWRPRWPSLLISLILVSLLAWLLPGFFGHVPRVAAFTGQLP
PFSPLPLLDMELMLRLLPSAVAVGMLGLVTSLSIARSLSARSEQLIDPDQEIRAQGLSNI
AGAFFSGYLSAGSFTRSGLSYEAGARSPMAGVFSALWVALFAVTGAGLIAHLPIPAMAGS
ILLICWGLVDHRGIRALFRVSRSEFLVMALTAAATLLLELQTAIYAGVLASLFFYLKRTS
RPRIQQSREGDADVLRVGGSIFFGAAHYLQVRLQRCQGPHVVIDARQVNFIDYSGVDMLH
REARRLRRLGGSLTLHRARPQVIEELQKLEGVELCPIRFEE
Download sequence
Identical sequences Q88RQ4
gi|26986820|ref|NP_742245.1| GO.8978 NP_742245.1.35174 WP_010951481.1.28295 WP_010951481.1.28475 WP_010951481.1.3142 WP_010951481.1.58218 WP_010951481.1.71439 WP_010951481.1.87606 160488.PP_0075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]