SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8985 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8985
Domain Number 1 Region: 443-551
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000051
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.8985
Sequence length 568
Comment $ NYCOMPS $ SQ227602 $ PDBT340506 $
Sequence
MFLSRWLPGLANLLHYRREWFHADLQAGLSVAAIQIPIAIAYAQIVGLPPQYGLYACVLP
MMVYALIGSSRQLMVGPDAATCAMIAGAVAPLAMGDPQRIVELSVIVTVLVGVMLIAAGL
ARAGFIASFFSRPILIGYLNGIGLSLIAGQLSKVVGFKIEGDGFILSLINFFQRLGEIHW
VTLIIGLAALGLLIWLPRRYPRLPAALTVVALFMLLVGLFGLDRFGVAVLGPVPAGIPQL
AWPHSNLAEMKSLLRDALGIATVSFCSAMLTARSFAARHGYAINANHEFVALGVSNLAAG
VSQGFAISGADSRTAVNDMVGGKSQLVGIIAALVIALILLFFTAPMAWIPQAALGAVLLM
AGWGLIDIKSLGHIRRLSRFEFWLCLLTTAGVLSLGVLPGIVFAVTLAILRLLYSIYQPT
DAVLGWLPGTEGQVDIRKFKDARTVPGLVVYRFDDAILFFNADYFKMRLLEAVQSQDQPK
AVLFDAEAVTSIDVSGIAALREVRDTLAAQGILFAIARARGTFLRMLVRSGMARDMEEKL
LFGSVRAGIRAYRVWRNRNRSVQVTEQG
Download sequence
Identical sequences Q88N09
NP_743566.1.35174 WP_010952515.1.28295 WP_010952515.1.28475 WP_010952515.1.3142 WP_010952515.1.58218 WP_010952515.1.71439 gi|26988141|ref|NP_743566.1| 160488.PP_1407 GO.8985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]