SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9013 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9013
Domain Number 1 Region: 401-486
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000373
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.9013
Sequence length 495
Comment $ NYCOMPS $ SQ176477 $ PDBT340534 $
Sequence
MLEKIKTTWFSNIRADVLAGLVVALALIPEAIAFSIITGVDPKVGLYASFCICVVIAFVG
GRPAMISAATGAMALLMVNLVKDHGLQYLLAATLLCGVLQIIAGYLRLGELMRFVSRSVV
TGFVNALAILIFMAQLPELTHVTWPVYAMTAAGLAIIYLFPRIPVAGRLLPSPLVCILVL
TAIAIYMGLDVRTVGDMGAMPDSLPTFMWPDVAPNFDTLLIILPYSAALAVVGLLESMMT
ATIVDDLTDTSSERNRECKGQGIANIASGLIGGMAGCAMIGQSMINVKSGGRTRLSTLSA
GILLLIMMLFLGDWLVRIPMAALVAVMIMVSISTFSWGSIRNLRQYPLSTNIVMVVTVAV
VVATHNLAYGVLVGSLLAAMFFASKIARYLDVTSRRDPEHSHRTYYVTGQVFFASADRFT
ASFDLREKVETLAIDLREAHFWDITAVAALDKVVLKLRRAGISVDVVGMNRATATLVDRF
GVHDKPDGIDSLMGH
Download sequence
Identical sequences Q880D6
223283.PSPTO_3234 APC63551 GO.9013 NP_793019.1.37326 WP_011104449.1.14276 WP_011104449.1.17870 WP_011104449.1.6959 gi|28870400|ref|NP_793019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]