SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9014 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9014
Domain Number 1 Region: 392-479
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000019
Family Anti-sigma factor antagonist SpoIIaa 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.9014
Sequence length 481
Comment $ NYCOMPS $ SQ227630 $ PDBT340535 $
Sequence
MKTIRMRAEVLAGLTTSFALVPECIAFALVAHLNPLMGLYGAFIICTLTALFGGRPGMVS
GAAGSMAVVIVALVVQQGVQYLLATVLLGGLIMILFGLLRLGKLVRLVPYSVMLGFVNGL
AIVIAMAQLEHFKVGESWLSGTSLYVMLGLVALTMAIVYLLPRITRVAPPALVAILSVGL
AVYLLGLPTRTLGDMAHIAGGLPVFALPDIPWNLDTLRIIAPYAILMALVGLLETLLTLN
LTDEITETRGYPDRECVALGAANMVSGAFGGMGGCAMIGQTVINLSSGGRGRVSGVVAGL
MILMFVLFLSPLIERIPLAALVGVMFVVAQQTFAWASLRVLRKVPVNDVLAIIAVTVVTV
LTDLATAVVFGIIIAAINFAWQQARELYADSHVEADGSKIYHLHGTLFFASTTPFLDQFN
PSEDPAQVTLDCRHLSFVDYSAIAALKTLRERYAKAGKHLRVVHLSDRCKRLLKRAGVQH
A
Download sequence
Identical sequences F3IFR6 Q87Z38
gi|28870753|ref|NP_793372.1| GO.9014 NP_793372.1.37326 WP_005765213.1.12126 WP_005765213.1.14276 WP_005765213.1.17870 WP_005765213.1.6959 WP_005765213.1.80269 WP_005765213.1.87092 223283.PSPTO_3593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]