SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9029 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9029
Domain Number 1 Region: 439-541
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000137
Family Anti-sigma factor antagonist SpoIIaa 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.9029
Sequence length 556
Comment $ NYCOMPS $ SQ227644 $ PDBT340550 $
Sequence
MFGSRFKDINFKGDIFGGVTTAIISLPLALAFGVASGAGAEAGLWGAIMVGLFASLFGGS
NTLISEPTGPMTVIMTAVLTSMMAKYPETGMAMTFTVVMMAGAFQILLGTLKMGKYVTLM
PYSVISGFMSGIGVILIILQLSPLLGHAAPAGGVLGTLSALPETISNLKFNELFLGLLTL
GILFFFPKKYRKYVPAQLVALVAVTLLSVMLFDTEDIRRIGEIPAGLPSLVAPHIDPDMF
VEMVIDALVLGTLGCIDTLLTAVIGDSLTRKEHDSDKELRGQGLANMISGLFGALPGAGA
TMGTVTNIQVGARSPLSGVVRALVLALVVLVAGGLTEPIPMAVLAGIAVYVGFNILDWSF
IQRAHKVSFSGMAIMYGVMLLTVFVDLIVAVGLGVFVSNIMIIERLSREQARQVKAISDA
DEDDVPLTDSERGLLDRANGRVLFFYLSGPMIFSVSKAISRQHTSISDYDVMILDLTDVP
MLDVTVGLALENAIKDALDARCEVYLLCPNQRTREQLEKFHVIDLVPDNNMYQFRYEALN
AAVAHVESDQYQRMTA
Download sequence
Identical sequences A0A0F6LUH9 A0A0L8SG77 Q87LU5
GO.9029 223926.VP2513 NP_798892.1.6614 WP_005479694.1.10142 WP_005479694.1.101585 WP_005479694.1.10999 WP_005479694.1.11583 WP_005479694.1.14243 WP_005479694.1.15211 WP_005479694.1.15563 WP_005479694.1.16073 WP_005479694.1.16503 WP_005479694.1.16742 WP_005479694.1.1836 WP_005479694.1.19074 WP_005479694.1.19755 WP_005479694.1.20587 WP_005479694.1.21130 WP_005479694.1.22008 WP_005479694.1.22854 WP_005479694.1.22951 WP_005479694.1.24866 WP_005479694.1.25390 WP_005479694.1.26080 WP_005479694.1.26245 WP_005479694.1.264 WP_005479694.1.26729 WP_005479694.1.27000 WP_005479694.1.27116 WP_005479694.1.29928 WP_005479694.1.31998 WP_005479694.1.330 WP_005479694.1.35351 WP_005479694.1.35596 WP_005479694.1.35751 WP_005479694.1.36788 WP_005479694.1.37148 WP_005479694.1.37683 WP_005479694.1.39 WP_005479694.1.39142 WP_005479694.1.39379 WP_005479694.1.3961 WP_005479694.1.39756 WP_005479694.1.39842 WP_005479694.1.41224 WP_005479694.1.41234 WP_005479694.1.42776 WP_005479694.1.42858 WP_005479694.1.43185 WP_005479694.1.43895 WP_005479694.1.45633 WP_005479694.1.46057 WP_005479694.1.4734 WP_005479694.1.48035 WP_005479694.1.4861 WP_005479694.1.48612 WP_005479694.1.4902 WP_005479694.1.49432 WP_005479694.1.49920 WP_005479694.1.5033 WP_005479694.1.50640 WP_005479694.1.50833 WP_005479694.1.51945 WP_005479694.1.52959 WP_005479694.1.53064 WP_005479694.1.53207 WP_005479694.1.53943 WP_005479694.1.54059 WP_005479694.1.55108 WP_005479694.1.55354 WP_005479694.1.5595 WP_005479694.1.56068 WP_005479694.1.56836 WP_005479694.1.56842 WP_005479694.1.57129 WP_005479694.1.57332 WP_005479694.1.5768 WP_005479694.1.58791 WP_005479694.1.5962 WP_005479694.1.59887 WP_005479694.1.60089 WP_005479694.1.60172 WP_005479694.1.606 WP_005479694.1.61129 WP_005479694.1.61745 WP_005479694.1.61756 WP_005479694.1.62401 WP_005479694.1.6274 WP_005479694.1.63316 WP_005479694.1.6404 WP_005479694.1.65279 WP_005479694.1.65345 WP_005479694.1.66211 WP_005479694.1.66850 WP_005479694.1.71278 WP_005479694.1.71997 WP_005479694.1.73712 WP_005479694.1.74603 WP_005479694.1.74813 WP_005479694.1.75461 WP_005479694.1.763 WP_005479694.1.79694 WP_005479694.1.81752 WP_005479694.1.81782 WP_005479694.1.81887 WP_005479694.1.82387 WP_005479694.1.82791 WP_005479694.1.8373 WP_005479694.1.84036 WP_005479694.1.8531 WP_005479694.1.86416 WP_005479694.1.86700 WP_005479694.1.88312 WP_005479694.1.90588 WP_005479694.1.91910 WP_005479694.1.92596 WP_005479694.1.92816 WP_005479694.1.93458 WP_005479694.1.93964 WP_005479694.1.94697 WP_005479694.1.96237 WP_005479694.1.9642 WP_005479694.1.96491 WP_005479694.1.99415 WP_005479694.1.99780 WP_005479694.1.99805 gi|28899287|ref|NP_798892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]