SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9036 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9036
Domain Number 1 Region: 446-554
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-19
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9036
Sequence length 559
Comment $ NYCOMPS $ SQ227651 $ PDBT340557 $
Sequence
MKLFEFKPKLVSCLKNYSKETFMADLMAGVIVGIVALPLAIAFGIASGVSPEKGIITAII
AGFIISLLGGSKVQIGGPTGAFIVIIYGIIQQYGEAGLIVATLMAGVLLILLGVFKLGAV
IKFIPYPIIVGFTSGIAVTIFTTQIADIFGLSFGGEKVPGDFVGKWMIYFRHFDTVNWWN
TIVSIVSIIIIAITPRFSKKIPGSLIAIIVVTVAVYLMKTYGGIDCIPTIGDRFTIKSEL
PDAVVPALDWEAIKNLFPVAITIAVLGAIESLLSATVADGVIGDRHDSNTELIAQGAANI
VAPLFGGIPATGAIARTMTNINNGGKTPIAGIIHAIVLLLILLFLMPLAQYIPMACLAGV
LVIVSYNMSGWRVFKALLKNPKSDVTVLLITFFLTVIFDLTVAIEVGLIIACVLFMKRVM
ETTEISVITDEIDPNKESDIAVNEENIMIPKGVEVYEITGPYFFGIATKFEETMAQLGDR
PNVRIIRMRKVPFIDSTGIHNLTTLCEMSQKEKITVILSGVNEKVYKVLEKSGFYELLGK
ENICPNFKIALDRAEEVMK
Download sequence
Identical sequences Q8A2X4
gi|29348590|ref|NP_812093.1| NP_812093.1.73244 226186.BT_3181 GO.9036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]