SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9046 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9046
Domain Number 1 Region: 431-534
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-16
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9046
Sequence length 539
Comment $ NYCOMPS $ SQ227661 $ PDBT340567 $
Sequence
MFKKYTQMIRDEFKGYNQKKMKKDFLAGLTVAAVALPLALAFGVSSGATAAAGMITAIIA
GIVIGSLSGGFYQISGPTGAMAAILMSIAAVHGMQGILLATFLAGIFLLLAGILRLGSLT
SFIPSPVITGFTSGIAIIIALGQLDNFFGVRSEGHNLIEKISSYRSLGFDLSIPTTVMSI
LVVLGLVFFPKKWNAMIPASLVMIILATLATVVFQLPVATVGKIPTSIFSDTRLELGSLQ
LSAFQDILVPSISIAMLGMIESLLCGASAGRMTGKPLDSNQELVAQGIGNLILPFFGGVP
ATAAIARTSVVIKSGAQTRLAGIFHAVFLLLSMLLLSPVMSKIPMPALAGVLVVTAWRMN
EWSVIKEFFQKRFHTALCLFFLTMVATVIFDLSLAIVLGVLAGCLFFIAKSAVITINVEE
VDWSRMGLVPTDCTENWVVVYLSGPLFFMSSERLKQTLLQLETKSGVVFSMRGVPSIDST
ALDILEEFCLAAEGRGQQVQFAALQPEVEKMIRTIQGNQEKEYHFSVAEFLQTVHVAEQ
Download sequence
Identical sequences Q82ZP6
226185.EF3004 NP_816619.1.90627 WP_010706788.1.100343 WP_010706788.1.100482 WP_010706788.1.101272 WP_010706788.1.101818 WP_010706788.1.10696 WP_010706788.1.11193 WP_010706788.1.12926 WP_010706788.1.13739 WP_010706788.1.14157 WP_010706788.1.14180 WP_010706788.1.16241 WP_010706788.1.16763 WP_010706788.1.17287 WP_010706788.1.17799 WP_010706788.1.18048 WP_010706788.1.18260 WP_010706788.1.20659 WP_010706788.1.23054 WP_010706788.1.23569 WP_010706788.1.24064 WP_010706788.1.25180 WP_010706788.1.274 WP_010706788.1.2799 WP_010706788.1.28932 WP_010706788.1.31656 WP_010706788.1.32099 WP_010706788.1.33306 WP_010706788.1.33460 WP_010706788.1.33574 WP_010706788.1.34192 WP_010706788.1.35810 WP_010706788.1.35823 WP_010706788.1.36900 WP_010706788.1.39119 WP_010706788.1.4014 WP_010706788.1.42483 WP_010706788.1.43903 WP_010706788.1.44185 WP_010706788.1.44242 WP_010706788.1.44626 WP_010706788.1.45925 WP_010706788.1.46056 WP_010706788.1.46348 WP_010706788.1.47407 WP_010706788.1.47856 WP_010706788.1.47867 WP_010706788.1.49131 WP_010706788.1.50938 WP_010706788.1.52926 WP_010706788.1.55065 WP_010706788.1.57048 WP_010706788.1.57136 WP_010706788.1.57211 WP_010706788.1.57542 WP_010706788.1.58620 WP_010706788.1.59698 WP_010706788.1.59964 WP_010706788.1.60361 WP_010706788.1.60394 WP_010706788.1.61083 WP_010706788.1.62847 WP_010706788.1.63148 WP_010706788.1.63507 WP_010706788.1.63848 WP_010706788.1.63884 WP_010706788.1.6473 WP_010706788.1.66316 WP_010706788.1.66843 WP_010706788.1.66898 WP_010706788.1.69648 WP_010706788.1.77328 WP_010706788.1.7819 WP_010706788.1.78503 WP_010706788.1.78641 WP_010706788.1.7958 WP_010706788.1.80104 WP_010706788.1.80452 WP_010706788.1.81327 WP_010706788.1.81575 WP_010706788.1.82993 WP_010706788.1.83490 WP_010706788.1.8380 WP_010706788.1.84260 WP_010706788.1.86134 WP_010706788.1.90371 WP_010706788.1.90503 WP_010706788.1.90872 WP_010706788.1.91394 WP_010706788.1.93277 WP_010706788.1.94630 WP_010706788.1.95534 WP_010706788.1.9570 WP_010706788.1.96481 WP_010706788.1.96745 WP_010706788.1.97078 WP_010706788.1.98868 WP_010706788.1.99 WP_010706788.1.9925 WP_010706788.1.99432 GO.9046 gi|29377465|ref|NP_816619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]