SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9053 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GO.9053
Domain Number - Region: 423-489
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00471
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9053
Sequence length 491
Comment $ NYCOMPS $ SQ227667 $ PDBT340574 $
Sequence
MRVVDVADAVGKLVNRSGKADLFASLVVFLVALPLCVGVAVASGVPAELGLVTGIVGGLV
AGALPGSSLQVSGPAAGLTVLVYEAVKTYGPQALGVLVLGAGLVQLALGVLRLGRWFRAV
SVAVVQGMLAGIGLVLVAGQVYAMGDVPSPASGAAKLAGLVSLPGDVAPVALLTGGATVL
VLVLWPRWRRGARAVPAPLLAVGLASAATALFDLPVRRVEVRGLLDVVRPPSVGDLGRLT
EVGVLGTVVAFALIASAESLFSAAAVDRLHGGRRTDYDRELIAQGTGNAVCGVLGALPMT
AVIVRSAANVRAGARTKASRVLHGVWLLVFTALLPEVLGVIPVAALAGLLVHAGAKLVPV
RELGALWRAHRGEAVVLGVTAVAIVIGNLFEGVLVGLALAVAKTAWDISHVHVETEDLGA
AGIVVRVVGHATFLRLPKLLDALEALPHDREVRLELGGLRHVDHACAAALDGWAAARQGG
QGRVATSSTSP
Download sequence
Identical sequences Q82E95
gi|29831264|ref|NP_825898.1| WP_010986145.1.19017 WP_010986145.1.30226 WP_010986145.1.49792 WP_010986145.1.60620 WP_010986145.1.68722 GO.9053 227882.SAV_4721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]