SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9056 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9056
Domain Number 1 Region: 387-471
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000182
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9056
Sequence length 483
Comment $ NYCOMPS $ SQ227670 $ PDBT340577 $
Sequence
MFQTIKNDWFSNVKGDVLSGIVVALALIPEAIAFSVIAGVDPTVGLYAAFCIAVTISFVG
GRTGMISAATGAMALLMVTLVKDHGLQYLFATTILTGIVQIIFGVFKLSSFMKFVPKSVM
SGFLNSLGILVFTAQLPHFKNATWQMYALVVLGLAIIYLFPRITTAVPSTLISIIIVTSI
ALMSGLQLKTVGDMGSLPKELPFFSIPDVPFTLETLGIILPYAVMLAIIGLLESLLTASV
LDDMTHTESNKHKEARGQGIANIVAGFFGGMAGCAMIGQSVINIKSGGRGRLSTFVAGGF
LIVLLFVLGDYVVHIPMAALVAVMIMVSIGTFDWNSVATIHKVPKGNAFVMIVTVVVVLI
THNLGLGVIIGTVISAVLFAFNMAKIHVKHLYIENKKIYEIHGQLFFASTADFINAFSLD
EGIKEIEMNFTHAHVWDDSAVASIDKVIMKYEQSGVKVSITGLNERSSKLVANLATYNKR
IAS
Download sequence
Identical sequences A0A164U7L8 A0A243DYV6 C2SWB1 Q81HX6
NP_830468.1.86172 WP_000487894.1.26637 WP_000487894.1.41518 WP_000487894.1.56320 WP_000487894.1.58822 WP_000487894.1.71114 WP_000487894.1.76902 WP_000487894.1.80649 WP_000487894.1.87768 WP_000487894.1.97842 226900.BC0654 gi|296501411|ref|YP_003663111.1| gi|30018837|ref|NP_830468.1| GO.9056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]