SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9060 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9060
Domain Number 1 Region: 398-476
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000167
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.9060
Sequence length 489
Comment $ NYCOMPS $ SQ227674 $ PDBT340581 $
Sequence
MFQKIAKECLAGFTVAIVALPLAIAFGIAATGTSEGALVGLYGAIFAGLFAALFGGTPGQ
VTGPTGPITVIATGVIATHGLEASFIAFMMAGLFQILFGVCKLGSYVRYIPYPVVSGFMN
GIALIIILGEIKHVQNSFLLVVLTIIVMIVSGKWIKAIPSSLVALVGVTALLPLFSSLLE
GLTVKLPIIGNLSLNKVIEKIGTIPEAMPTLHIPSLSGTGIAALILSALSIALLGSIDSL
LTSVVMDNVTGTRHKSNKELVGQGIGNMMSGLFGGLAGAGATVRSIVNIRSGGKTALSAC
MHSVILFIFIMGLGSVVQYIPLAVLSGILILTGIGMFDWGSMKKMHVAPKGDVVVMLVTM
IVTVKFDLMIAVAFGIILSFIIYMVKCKERKTSIVKEKEETYKIQGPLSFLSVDRIFSTL
QDVKSPVILRMKDVRYMDVSGAMALLNFVEQSNKVGASVKLEQVHPSIEKTIAVMASDEQ
KEQLKILSV
Download sequence
Identical sequences A0A164RI77 Q81HC2
GO.9060 NP_830679.1.86172 WP_000486659.1.26637 WP_000486659.1.58822 WP_000486659.1.76902 226900.BC0893 gi|30019048|ref|NP_830679.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]