SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9070 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GO.9070
Domain Number - Region: 424-494
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00523
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9070
Sequence length 516
Comment $ NYCOMPS $ SQ227682 $ PDBT340591 $
Sequence
MILDKNSCRLFKQNFASGVVVFLVALPLCLGIALASGAPPLAGVIAGIIGGIIVGSLSTS
HISVAGPAAGLVTVVLVAITQLGRFELFLCAGIICAVIQIILGSLRAGSITNYIPIAVIE
GMLAGIGILIITSQLPYAFGNKHLFNELSLSFINIHLGSLIISLLSLLMMLGWERSATLK
SIKMLPSALIAVIMSIGLNKLFAGTPLAIPESQLVQLPIAHSWAEIGDLLYFPDWAGFHY
SIVWSTGITMAIVASIETLLSIEAADRIDSKRRITDTNQELKAQGIGNLVSALMGGLPIT
AVIVRSSANANAGETHKISSILHGLLLLVCVLTIPTMLNQIPLATLAAVLILVGYKLTRP
AVFQHFWQKGLYQFIPFLTTAIAVVALDLLKGVGLGLIISILFILQGNMKRAYYLSREEL
ANANYIKIRLAEEVSFLNKAAIKKTLKNIHPNAKVIIDATQTTYIASDVLELIEDFANIT
SRENNIRVYLKGFKSDYNNQEIGHASHITVEHSRRI
Download sequence
Identical sequences Q7VME4
GO.9070 gi|33152170|ref|NP_873523.1| 233412.HD1034 WP_010944962.1.19715 WP_010944962.1.34146 WP_010944962.1.69448 WP_010944962.1.77494 WP_010944962.1.78970 WP_010944962.1.84729 WP_010944962.1.99406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]