SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9078 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9078
Domain Number 1 Region: 445-551
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-19
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.9078
Sequence length 558
Comment $ NYCOMPS $ SQ227690 $ PDBT340599 $
Sequence
MIGSYFRPKLLDVFHGYNRERFMADLMAGVIVGIVALPLAIAFGIASGVSPETGLITAII
GGFIVSLLGGSSVQIGGPTGAFIVIVYGIIHKYGIEGLTIATIIAGILLLVMGVLRLGTL
IKFIPYPIVVGFTAGIALTIFSTQMNDLFGLGITDMPGDFLGKWGAYFTNFKSVNLWAFG
MGLLSIVIIMLSPRFTKKIPGSLIAIILMTVAAYLLRLQGIGEFETIGDRFTISAQLPKP
TGVTLSLETIRQLFPPAFTIALLGAIESLLSASVADGVIGEKHNSNTELIAQGAANIVVP
FFGGIPVTGAIARTMTNINNGGRSPIAGIIHAFVLLLILLFLGPLTAYIPMACLAGVLII
VSYNMSGWRSVANIGRGPRSDSLVMLVTFLLTVILDLTVAIEIGLLLAILLFMKRVTENT
RITVATGRLDLTQTGEIAHHDEVLDIPKGVEVYEIEGPFFFGIANRFEEIMNTLGDHPDV
RIIRMRHVPFMDSTGMHNLENLIKMSRKEGVSIVLSGVRKDVHEELATAGIVELLGEENV
CADIQAALRQAQAIAQGA
Download sequence
Identical sequences A0A0E2LPV1 A0A2I7MNF7 B2RGP1 Q7MXX5
242619.PG0022 431947.PGN_0017 gi|34539900|ref|NP_904379.1| WP_005874466.1.19526 WP_005874466.1.22258 WP_005874466.1.22416 WP_005874466.1.38730 WP_005874466.1.39476 WP_005874466.1.48852 WP_005874466.1.6507 WP_005874466.1.73823 WP_005874466.1.79666 WP_005874466.1.99224 WP_005874466.1.99922 gi|188993881|ref|YP_001928133.1| GO.9078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]