SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9089 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9089
Domain Number 1 Region: 396-475
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9089
Sequence length 498
Comment $ NYCOMPS $ SQ227699 $ PDBT340610 $
Sequence
MFQKIAKECLAGFTVAIVALPLAIAFGIAATGTSEGALVGLYGAIFAGLFAALFGGTPGQ
VTGPTGPITVIATGVIATHGLEASFIVFMMAGLFQILFGVCKLGSYVRYIPYPVVSGFMN
GIALIIILGEMKHVQNSFLLVVLTIIVMIVSGKWIKAIPSSLVALVGVTAMLPLFSSALE
GLTVKLPVIGNLSLNKVIEKIGTIPEAMPTLHIPSLSGTGIAELILPALSIALLGSIDSL
LTSVVMDNVTGTRHKSNKELVGQGIGNVMSGLFGGLAGAGATVRSIVNIRSGGKTALSAS
MHSVILFIFIMGLGSVVQYIPLAVLSGILILTGIGMFDWESMKKMHVAPKGDVVVMLVTM
IVTVKFDLMIAVAFGIILAFIIYMVKCKERKASIVKEKEAIYKIKGPLSFLTVDRVFYAL
QDVKSPVVLRMKDTRYMDVSGAMALLNFIEQSGKSGLSVTLEQVPAHIEKILVTMASSEQ
KDKLLFTEADVMQGNALV
Download sequence
Identical sequences A0A150EKP5 Q73CU6
gi|42780044|ref|NP_977291.1| 222523.BCE_0968 WP_000486700.1.39001 WP_000486700.1.45089 WP_000486700.1.49802 GO.9089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]