SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9094 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9094
Domain Number 1 Region: 445-553
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.26e-20
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9094
Sequence length 568
Comment $ NYCOMPS $ SQ227702 $ PDBT340615 $
Sequence
MAIPSGATGKEPFLPRTLTVLREGYDGGTFFKDLAAGLTVGIVALPLAMAFAIASGTTPE
RGLFTAIVAGFLISLLGGSRYQIGGPTGAFVIIIFNVIMKHGYDGLVVTTLLAGAMLLVF
GLCRFGALIKYIPYPVTTGFTAGIAVLIFSQQVKDFLGLSMQSVPPDFFEKWQAYIHNAA
TFDPATCGIAFLALGAIILTRKTIPRIPGPVVGVVLASLTVWALGLDVETIGSRFGGIPT
ELPTFTLPTVTLERVRQLLPDAMTIALLAGIESLLSCVVADGMTGDKHNSNVELAAQGAA
NIASVMFGGIPATGAIARTVTNIRSGGRTPVAGMIHAAVLVGFILYLAPLASFIPLASLA
AVLMVVAWDMSEMHKFLRLLHAPKSDVLVMCLTFALTVVIDLTVAVYVGVMLASLLFMRR
MSEVTQICTCLDGEATKVQGRETAELDVPEGVKVYEIDGPFFFGVADRFQNVLAALDRQP
EVFILRMRKVSTLDSTAVNALEVFWRKCRSDGTQLLLSGVRETMRTTLRRMGTLSLIGEG
NICENIDAALARAGQVLAERREAEDRPQ
Download sequence
Identical sequences A0A0E0SYN3 Q72FD5
WP_010937588.1.14085 YP_009503.1.77684 882.DVU0279 gi|387152123|ref|YP_005701059.1| GO.9094 gi|46578695|ref|YP_009503.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]