SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9096 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9096
Domain Number 1 Region: 453-559
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000844
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 
Domain Number 2 Region: 600-707
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000365
Family cAMP-binding domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9096
Sequence length 714
Comment $ NYCOMPS $ SQ227704 $ PDBT340617 $
Sequence
MVPALALGLVIGVLLVVIGVSFAAMIFSGPLAPLATRGAGLTLFGAASLCGFLAVSSSFR
SAISTPQDAPVAVLATMGVPVVAAMGMSDPNATFATMLAAMSIATLATGIALMAIGHFRL
TRFFRFMPYPVVGGFLAGGGWMLVKGGISVMSSLSLNVESLPMLFESVHIWKWSPGVLYA
ISLWLVLKRWSHFLILPCSIVMVTAAYYVAFHILAISLADARAAGILLSGVPSSGLWPAF
SISDLQTVRWDIVFDQTPIMFTVVLVTMMGLLLNISGLELGSGTDIDFDREFRNAGLANT
LGGLGGSAPGSHTLSLSLLCSSSGAYTRLAGIITASVIAAVLFMGGSVLEYFPLPVLGGL
LVFLGIDIMDSWLRATRRRLPLSDYLVLCVIFLVICFSGFLEGVAVGLVITVVLFIIRLS
KVDIIHDSFTGLTLHSRVNRSIPQRTILQQHGERIRGYRLSGYLFFGSASLLVETLKQEL
RKTPQPWCILLDFKNVSGFDISAANAFQRFISSAHAEHVRIVLTETSPRFISMLQRILPI
ESIDNLVTAQDIDRGLEACEEAILTEYTERTAQQANAADMLFEQSVDDMMAHLDRQILFE
ALVEELRPWVQECHYEGETLLVEKGKTQQGLQMLVWGSATATDGDGGTRLAHLRAGDVLV
PQAAFAPFVAREHIMADSPCRTVLLTAQARLLMEQENPDLALRLDRYVISSWKA
Download sequence
Identical sequences Q72AJ3
882.DVU1999 WP_010939285.1.14085 YP_011216.1.77684 GO.9096 gi|46580408|ref|YP_011216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]