SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9108 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9108
Domain Number 1 Region: 457-561
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000196
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.9108
Sequence length 564
Comment $ NYCOMPS $ SQ227714 $ PDBT340629 $
Sequence
MKTHGINGIRPFSALIDACWREKYTLQRFTHDIIAGVTVGIIAIPLAMALAIASGVPPQY
GLYTSAIAGIVIAVSGGSRYSVSGPTAAFVVILYPVSQQFGLSGLLVATLLSGVFLLLMG
LCRFGRLIEYIPLSVTLGFTSGIAITIGTMQIKDFFGLQMAVVPEHYVEKVAALAQALPT
LHLADTLIGATTLLVLIVWPRLGIRLPGHLPALLAGVAVMGIMSLVGENVATIGSRFSYM
LADGSQGQGIPPILPQLVLPWNIPSPDGKTMTLDWQSISALLPAAFSMAMLGAIESLLCA
VVLDGMTGKKHNSNAELMGQGFGNIIAPFFGGITATAAIARSAANVRAGANSPVSAVIHA
LLVLLALLILAPWLSYLPLAAMASLLLIVAWNMSEAHKVVDLLRHGPKDDIIVMLLCMSL
TVLFDMVIAITVGIVLASLLFMRRIAQMTRLSELPDTKIPDHLVLRVNGPLFFAAAERIF
NDLTVRSEGYQNIILQWDAVPVLDAGGLNAFLRFSETLPEGKQLIITDIPFQPLKTLARA
KVHPIEGRLSFYGSLAQAIEATTK
Download sequence
Identical sequences Q6D5M0
218491.ECA2021 gi|50120948|ref|YP_050115.1| GO.9108 WP_011093582.1.79946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]