SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9109 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9109
Domain Number 1 Region: 410-490
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000746
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.9109
Sequence length 499
Comment $ NYCOMPS $ SQ227715 $ PDBT340630 $
Sequence
MISSPDATPTPVQSTTSTLAALRSPSLLMREILAGTITALALIPEVISFSIIAGVDPKVS
LIASIVLCFTMSFLSGRPAMVTAAAGAVALVIGPMVHAHGVAYILPAVIMAGLIQILFGL
AGLARMMRYIPRSVMIGFVNALSILIFAAQVPHVYGHSSLVWLLFALTVAIVLLLPYVVK
SIPAPLVAIVTVTAIAMFTGITVPNVGDAGPMQPGLPGFTHWLVPFNVETLRIIWPTALS
IAFVGLMESLLTAKLVDDITDTPSSKRRECWGLGVSNIFAGFYGGIAGCAMIGQTVVNVE
LGKARTRISTLAAALVLLLLVTGLSEIMAKIPMVVLAGIMMIVALKTMNWHSLRPTTLKR
MPLSETLVVVVTVIATVSTANLAIGVAGGVIFAILLFARRVAHVIHAERRVSEDGQSVHY
TVRGPLFFGSSNDLFEHFLYAQDPQNVTIDLTHAQIWDASSVAALDAIETRYHRYDAKVA
IIGLDNHSSKIHQRLSGHL
Download sequence
Identical sequences Q6D2Y6
gi|50121882|ref|YP_051049.1| 218491.ECA2958 GO.9109 WP_011094489.1.17763 WP_011094489.1.57850 WP_011094489.1.79946 WP_011094489.1.80346 WP_011094489.1.94180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]