SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9128 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9128
Domain Number 1 Region: 438-543
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-18
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9128
Sequence length 567
Comment $ NYCOMPS $ SQ227733 $ PDBT340649 $
Sequence
MNTITESYRAGLFQKKYWLQNIISGLIVGVVALPLAMAFAIASGAKPEQGLYTAIVAGLI
VSIMGGSRVQIAGPTGAFIVVLSGITAQYGISGLQIATLMAGFILVLFGFARLGSIIKFI
PSPVIIGFTSGIAVVIWVGQWQYFFGLPAAGSGHFHEKFWHLLLSFPHMNIATTFLGICA
LFIVLYSSKLPGLKRIPGPLIALVLVTIIQSVWHFEGVATIGSLFGGIPQGLPAFTWPEI
TMGRLIELIGPAFAIAMLGAIESLLSAVVADGMSGTRHNSNRELVGQGIANIVAPLFGGF
AATGAIARTATNIRNGGNSPLSGIIHSITLILVLLFLAPLAVDVPLAALAAILFVVSWNM
SEARHFIKLIRVAPRADVVILLVTFCLTVFVDLVVAVNVGVIIAVLHFLRRMVNSIQIQR
MSEGQLSQELAQEKNYDLPEGVMVYVIEGPFFFGAVETFQSALANTHTDPKVLIIRMRWV
PFIDVTGLQAMEEIILNLQKRGVRVLLSEANPLVDAKLRKMGIVQLIGEQNYYKEFSQAL
DVCRINDSDRKSQPPFEVAKPLASVTQ
Download sequence
Identical sequences A0A1S0VCJ8 A0A2J9NLB5 G8UXM4 Q5ZXD0
gi|397666480|ref|YP_006508017.1| gi|378776751|ref|YP_005185188.1| GO.9128 272624.lpg0802 297246.lpp0864 gi|52841038|ref|YP_094837.1| gi|54296823|ref|YP_123192.1| gi|470183085|ref|YP_007568960.1| WP_010946538.1.100609 WP_010946538.1.100881 WP_010946538.1.101385 WP_010946538.1.10160 WP_010946538.1.11666 WP_010946538.1.1173 WP_010946538.1.1188 WP_010946538.1.12035 WP_010946538.1.12661 WP_010946538.1.14160 WP_010946538.1.14235 WP_010946538.1.15016 WP_010946538.1.15769 WP_010946538.1.16078 WP_010946538.1.16593 WP_010946538.1.16748 WP_010946538.1.16962 WP_010946538.1.17809 WP_010946538.1.17857 WP_010946538.1.19321 WP_010946538.1.19554 WP_010946538.1.19781 WP_010946538.1.20369 WP_010946538.1.2062 WP_010946538.1.2085 WP_010946538.1.21466 WP_010946538.1.21493 WP_010946538.1.21849 WP_010946538.1.21924 WP_010946538.1.22734 WP_010946538.1.22766 WP_010946538.1.2333 WP_010946538.1.23459 WP_010946538.1.24053 WP_010946538.1.24333 WP_010946538.1.2441 WP_010946538.1.24636 WP_010946538.1.25422 WP_010946538.1.26718 WP_010946538.1.27038 WP_010946538.1.27674 WP_010946538.1.28040 WP_010946538.1.28814 WP_010946538.1.29318 WP_010946538.1.29802 WP_010946538.1.30351 WP_010946538.1.30583 WP_010946538.1.30822 WP_010946538.1.3122 WP_010946538.1.31291 WP_010946538.1.3258 WP_010946538.1.32615 WP_010946538.1.32659 WP_010946538.1.33479 WP_010946538.1.33708 WP_010946538.1.35118 WP_010946538.1.35787 WP_010946538.1.35807 WP_010946538.1.36420 WP_010946538.1.37108 WP_010946538.1.37161 WP_010946538.1.37274 WP_010946538.1.37932 WP_010946538.1.3819 WP_010946538.1.38679 WP_010946538.1.39582 WP_010946538.1.41185 WP_010946538.1.41378 WP_010946538.1.41396 WP_010946538.1.41414 WP_010946538.1.41486 WP_010946538.1.43838 WP_010946538.1.44619 WP_010946538.1.44866 WP_010946538.1.44947 WP_010946538.1.45024 WP_010946538.1.45039 WP_010946538.1.46042 WP_010946538.1.46096 WP_010946538.1.46948 WP_010946538.1.47823 WP_010946538.1.47956 WP_010946538.1.48346 WP_010946538.1.48987 WP_010946538.1.49562 WP_010946538.1.50379 WP_010946538.1.51153 WP_010946538.1.51428 WP_010946538.1.51956 WP_010946538.1.52706 WP_010946538.1.52905 WP_010946538.1.53250 WP_010946538.1.53443 WP_010946538.1.53669 WP_010946538.1.53795 WP_010946538.1.53844 WP_010946538.1.54355 WP_010946538.1.54450 WP_010946538.1.547 WP_010946538.1.5553 WP_010946538.1.57055 WP_010946538.1.58425 WP_010946538.1.58541 WP_010946538.1.58606 WP_010946538.1.5861 WP_010946538.1.58655 WP_010946538.1.59183 WP_010946538.1.59227 WP_010946538.1.59576 WP_010946538.1.60239 WP_010946538.1.60770 WP_010946538.1.61482 WP_010946538.1.61895 WP_010946538.1.6243 WP_010946538.1.63249 WP_010946538.1.63282 WP_010946538.1.63357 WP_010946538.1.636 WP_010946538.1.64335 WP_010946538.1.64388 WP_010946538.1.64512 WP_010946538.1.64714 WP_010946538.1.64856 WP_010946538.1.65356 WP_010946538.1.65604 WP_010946538.1.6601 WP_010946538.1.66209 WP_010946538.1.66299 WP_010946538.1.6641 WP_010946538.1.67348 WP_010946538.1.68412 WP_010946538.1.68702 WP_010946538.1.69197 WP_010946538.1.69880 WP_010946538.1.70346 WP_010946538.1.71556 WP_010946538.1.72557 WP_010946538.1.728 WP_010946538.1.73029 WP_010946538.1.73276 WP_010946538.1.73409 WP_010946538.1.73575 WP_010946538.1.73915 WP_010946538.1.74197 WP_010946538.1.74438 WP_010946538.1.74594 WP_010946538.1.75016 WP_010946538.1.75353 WP_010946538.1.75911 WP_010946538.1.75926 WP_010946538.1.76298 WP_010946538.1.76893 WP_010946538.1.77472 WP_010946538.1.77852 WP_010946538.1.77866 WP_010946538.1.79027 WP_010946538.1.79030 WP_010946538.1.79423 WP_010946538.1.79768 WP_010946538.1.80208 WP_010946538.1.80678 WP_010946538.1.80817 WP_010946538.1.81040 WP_010946538.1.81849 WP_010946538.1.81970 WP_010946538.1.82765 WP_010946538.1.82883 WP_010946538.1.83499 WP_010946538.1.8363 WP_010946538.1.83690 WP_010946538.1.84032 WP_010946538.1.84081 WP_010946538.1.85699 WP_010946538.1.86349 WP_010946538.1.87629 WP_010946538.1.87656 WP_010946538.1.88081 WP_010946538.1.89129 WP_010946538.1.89135 WP_010946538.1.89155 WP_010946538.1.89171 WP_010946538.1.90390 WP_010946538.1.90392 WP_010946538.1.90650 WP_010946538.1.91040 WP_010946538.1.91480 WP_010946538.1.93200 WP_010946538.1.94262 WP_010946538.1.95686 WP_010946538.1.96018 WP_010946538.1.96370 WP_010946538.1.97528 WP_010946538.1.97635 WP_010946538.1.97870 WP_010946538.1.97946 WP_010946538.1.98470 WP_010946538.1.98928 YP_094837.1.86292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]