SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9131 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9131
Domain Number 1 Region: 549-705
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.45e-25
Family cAMP-binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 458-565
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000012
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.9131
Sequence length 725
Comment $ NYCOMPS $ SQ133413 $ PDBT340652 $
Sequence
MRGRMTRSQLILAILAGLVISIDNMISIVAFSSLIYQGALEIYIPLVINILAISVIIISA
SYLFMSSPPYAIAQLQDEAAILYSAMGLVIIKSMPSSSTNEAIFITILFMLGVTTCLTGL
SFYFVGKFRFGNIIRYLPYPVICGFMAATGWLVLSGTFALLTGKALHQNWLVFFHKEEIL
LWAPGFIAGIVVYIFKEKLGYRYALQLMFISLVILFYALFYIFNLEYLVDPTEGYVLGPF
NQSHIDSLMKPEIWQMIHYPFSMTLLNYIGLVILVSFIALLLNASSYELIVNKQLDLNKE
LRIAGIGNVFSGLLGGMVGYLSLSASTVAKEYGGARIIGVMAFVPMLLILCFGAVVVECF
PKMAIGCYLFYIAFCFLSEWLINTWRLLNLSEYLIVLLILVIAIVFNMITAVAIGTVISI
FIFAFRYSKINPVKYLFSGADYNSSFERNPISQSILSTQGDEIQFLKLQGFLFFGSIYRL
LQLIKSIQKARYIILDFELVYNIDSSRIILMKNLKLHAEKNNISFAICSLKPIVYHELMK
TNLLQSKTNWLKVFTDQESALEWCEDQVIEKYTENINIEEVTLEKQLLYLGFSSELVAWI
SEKASIKPYNPDDIICHEGEESNSVYFIHRGRVTAFVGDKRVLVVGSGNVLGEIAIYTHK
KRTATLKTNEKTIVYEIDLKSIQELSKNKPLLLVQFHVCMAKILANRLSVLNKRIKVFDS
TAILQ
Download sequence
Identical sequences A0A2J9NF33 G8UXG5 Q5ZR85
WP_010948682.1.100881 WP_010948682.1.101385 WP_010948682.1.10160 WP_010948682.1.11666 WP_010948682.1.1188 WP_010948682.1.12035 WP_010948682.1.12661 WP_010948682.1.14235 WP_010948682.1.15016 WP_010948682.1.16078 WP_010948682.1.16593 WP_010948682.1.16748 WP_010948682.1.16962 WP_010948682.1.17430 WP_010948682.1.17857 WP_010948682.1.19321 WP_010948682.1.19554 WP_010948682.1.20369 WP_010948682.1.2062 WP_010948682.1.2085 WP_010948682.1.21466 WP_010948682.1.21493 WP_010948682.1.21924 WP_010948682.1.22734 WP_010948682.1.22766 WP_010948682.1.2333 WP_010948682.1.23459 WP_010948682.1.24053 WP_010948682.1.24333 WP_010948682.1.2441 WP_010948682.1.24636 WP_010948682.1.24881 WP_010948682.1.26718 WP_010948682.1.27038 WP_010948682.1.27501 WP_010948682.1.27674 WP_010948682.1.28814 WP_010948682.1.29318 WP_010948682.1.29802 WP_010948682.1.30583 WP_010948682.1.30653 WP_010948682.1.30822 WP_010948682.1.31291 WP_010948682.1.32608 WP_010948682.1.32615 WP_010948682.1.32659 WP_010948682.1.33479 WP_010948682.1.35118 WP_010948682.1.35787 WP_010948682.1.36420 WP_010948682.1.37108 WP_010948682.1.37274 WP_010948682.1.37932 WP_010948682.1.3819 WP_010948682.1.38679 WP_010948682.1.40870 WP_010948682.1.41185 WP_010948682.1.41378 WP_010948682.1.41486 WP_010948682.1.44619 WP_010948682.1.44866 WP_010948682.1.45024 WP_010948682.1.46042 WP_010948682.1.46096 WP_010948682.1.47823 WP_010948682.1.47956 WP_010948682.1.48346 WP_010948682.1.51153 WP_010948682.1.51428 WP_010948682.1.51956 WP_010948682.1.52283 WP_010948682.1.5252 WP_010948682.1.52706 WP_010948682.1.52905 WP_010948682.1.53250 WP_010948682.1.53261 WP_010948682.1.53669 WP_010948682.1.53795 WP_010948682.1.53844 WP_010948682.1.54355 WP_010948682.1.57055 WP_010948682.1.57468 WP_010948682.1.58606 WP_010948682.1.58931 WP_010948682.1.59227 WP_010948682.1.59576 WP_010948682.1.60239 WP_010948682.1.60770 WP_010948682.1.61895 WP_010948682.1.62077 WP_010948682.1.63282 WP_010948682.1.636 WP_010948682.1.64335 WP_010948682.1.64388 WP_010948682.1.64512 WP_010948682.1.64856 WP_010948682.1.66209 WP_010948682.1.66299 WP_010948682.1.68412 WP_010948682.1.68702 WP_010948682.1.69197 WP_010948682.1.70346 WP_010948682.1.70691 WP_010948682.1.7124 WP_010948682.1.71556 WP_010948682.1.73029 WP_010948682.1.73915 WP_010948682.1.74438 WP_010948682.1.75353 WP_010948682.1.75911 WP_010948682.1.76298 WP_010948682.1.76893 WP_010948682.1.77472 WP_010948682.1.77852 WP_010948682.1.77866 WP_010948682.1.79027 WP_010948682.1.79030 WP_010948682.1.80678 WP_010948682.1.80733 WP_010948682.1.80817 WP_010948682.1.81970 WP_010948682.1.82765 WP_010948682.1.83499 WP_010948682.1.8363 WP_010948682.1.84081 WP_010948682.1.85699 WP_010948682.1.86349 WP_010948682.1.86607 WP_010948682.1.87629 WP_010948682.1.87656 WP_010948682.1.88081 WP_010948682.1.89135 WP_010948682.1.89155 WP_010948682.1.89171 WP_010948682.1.90392 WP_010948682.1.90650 WP_010948682.1.91256 WP_010948682.1.91480 WP_010948682.1.93200 WP_010948682.1.94508 WP_010948682.1.9567 WP_010948682.1.9568 WP_010948682.1.96018 WP_010948682.1.96198 WP_010948682.1.97528 WP_010948682.1.97635 WP_010948682.1.98163 WP_010948682.1.98470 WP_010948682.1.98928 YP_096990.1.86292 APC88842 GO.9131 gi|52843191|ref|YP_096990.1| gi|378778880|ref|YP_005187322.1| 272624.lpg2998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]