SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9152 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9152
Domain Number 1 Region: 460-574
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-18
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.9152
Sequence length 582
Comment $ NYCOMPS $ SQ227753 $ PDBT340673 $
Sequence
MNQQLRGLARTYLPILDWGRSYGRGELSGDLIAAVIVTVMLIPQSLAYALLAGLPAEVGL
YASILPLVAYALFGTSRALAVGPVAVISLMTASALAPLNLSSVSEYVAAAGVLALLSGAM
LLLMGALRLGVVANFLSHPVIAGFITASGLLIAASQLKHILGVPLHGHTLPEILLDLARH
LGQINLATLVTGIVALAFLFWVRKGLAQVFHARLGLTKPLAATLARVGPIFAVIGTTLAA
WVLNLPSLGVAVVGEVPTGLPPLGLSGVDWGLVPALIGPAALLSIIGYVESVSVAQTLAT
KRKQRIDPNQELIALGAANISSSLSGGYPVTGGFARSVVNFDAGAETPAAGVFTAVGLLV
AALFLTPLLYFLPKATLAATIIVAVLSLVDLSILSRAWRYSRADFAAVFATIALTLLAGV
EVGVASGVLISLLLFVWKTSRPHVAEVGQVPGSQHFRNILRHKVETDPGVVTLRIDESLY
FANARRMEDLILNRVLRDRDSLRHVILMCSAVNEVDFSALESLEAINRRLDDLGVKLHLS
EVKGPVMDRLARSHFLEDLTGRVFLSQYDAFAALRMNRADRM
Download sequence
Identical sequences Q5LS14
246200.SPO1956 GO.9152 WP_011047687.1.46818 gi|56696829|ref|YP_167191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]