SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9173 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9173
Domain Number 1 Region: 439-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000922
Family Anti-sigma factor antagonist SpoIIaa 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.9173
Sequence length 551
Comment $ NYCOMPS $ SQ227773 $ PDBT340694 $
Sequence
MFGQRFDNINLKGDLFGGVTTAIISLPLALAFGVASGAGAEAGLWGAIMVGLFASLFGGS
STLISEPTGPMTVIMTAVLTSMVAKYPETGMAMTFTVVMMAGAFQILLGTLKLGKYITLM
PYSVISGFMSGIGVILIILQLSPLLGHAAPPGGVIGTLSALPDTLSNLDIKELFLGGLTL
GVLFLFPDKYRKYVPAQLVALVAVTLLSVLFFDMESIRRIGEIPAGLPSLVIPTINFEMF
TTMVIDALVLGTLGCIDTLLTAVIGDSLTRKEHDSDKELRGQGLANMISGLFGALPGAGA
TMGTVTNIQVGARSPLSGVFRAAVLALVVLVAGGLTEPIPMAVLAGIAVYVGFNILDWSF
IQRAHKVSFAGMAIMYGVMLLTVFVDLIVAVGLGVFISNIIIIERLSREQARQVKAISDA
DEDDVPLTDSERALLDKANGKVLFFYLSGPMIFSVSKAISRQHSSISDYEVMILDLTDVP
MIDVTVGLALENAINDALDANCKVYLLCPNEQTKEQLDKFHVTDLIPSENTYKFRYEALK
SAIKYVSPSED
Download sequence
Identical sequences Q5E2S8
gi|59712780|ref|YP_205556.1| 312309.VF_2173 GO.9173 WP_011262614.1.76652 YP_205556.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]