SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9193 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9193
Domain Number 1 Region: 432-524
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000104
Family Anti-sigma factor antagonist SpoIIaa 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.9193
Sequence length 557
Comment $ NYCOMPS $ SQ227791 $ PDBT340714 $
Sequence
MATEPLTHPTAAPKRTRDLLAGLSIAGLLLPEAVAYSSIAALPPQAGVIALFAGLLCYGL
LGTSRFAIVSATSSSAAVLAAATLSLAGGDAQLRLSLAFALVLLTGVFFLLAGLFRLGGV
TAFIAKPVLRGFAFGLALTIVLKQFATVVGVHLSTGNLVRFLPQLLEQWPQWNWAGAAVA
AVALLVLGICSRIPYVPGGLVAVVIGIGAGQWFNLPAHGVDLIGVIELKLEVPSLPQLPF
ADWLRLGELAFALVMILYAESYGSISSFALKHGDRVSSNRDLLALGASNLLSGLFHGMPA
GAGYSATSANEAAGARSRLAGLTAAAVMLLIVLTVLPYIALTPEPVLAAIVMYALGHGLS
LQPLGRYFIWRRDRVLVICAVSAVLVLGVLDGLLLSVGISILLLLRQMSAADIQILGQLG
SGHDFVDLSRHPQARQVPGVLILRPGEALFFANAERILGGALRLIRHVQAPIHSIILSLE
ESPDLDGTSIEALDEFFRQVSLEHKHLALARLKHEAKDALALLPSSREYQVLLSGTSVDD
TLQESLRGWKAGAFSQA
Download sequence
Identical sequences A0A2K2WKV9 Q4KDE4
WP_011060928.1.14038 WP_011060928.1.18072 WP_011060928.1.42693 GO.9193 gi|70730000|ref|YP_259739.1| 220664.PFL_2632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]