SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9199 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9199
Domain Number 1 Region: 426-511
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000451
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9199
Sequence length 522
Comment $ NYCOMPS $ SQ227795 $ PDBT340720 $
Sequence
MAWPDRQSLLPLLSWLPRQTRASVGRDLLVGLSGAILALPQSIAYALIAGLPPEYGLYAA
IVPVLIACLWGSSWHLICGPTAAISIVLYASVSPLAVPASEDYITLILLLTLLAGVFQWL
LGMLRFGALVNFVSHSVVLGFTLGAAVVIALGQLPNLLGLELPNQATALNSLSQLLQHLG
EVDRPSLLLGLGTLALGVAFKLLAPRWPGLLLSLVFSALVVWLLPGVFGHVQLVSAFVGR
LPPFSPLPLDLELILRLLPSAVAVGMLGLVTSLSIARSLSARSEQLLDANQEVRAQGLSN
MVGAFFSGYLSSGSFTRSGLSYEAGACSPLAGVFSALWVALFAVAGAGLIAHIPIPAMAG
SILLICWGLVDHRGIRALFRVSRAEFVVMSLTCVATLLLELQTAIYAGVLASLFFYLKRT
SQPRVQQSSEGDEDILRVGGSIFFGASHYLQVRMQRCHAPRLVIDARQINFIDYSGVEML
HQEARRLRRQERSLILRRARQAVKEELIKLEGPERCPIHFED
Download sequence
Identical sequences Q4KKQ2
220664.PFL_0029 GO.9199 WP_011058418.1.100210 WP_011058418.1.11424 WP_011058418.1.14038 WP_011058418.1.1721 WP_011058418.1.18072 WP_011058418.1.21308 WP_011058418.1.41899 WP_011058418.1.42693 WP_011058418.1.462 WP_011058418.1.6225 WP_011058418.1.67749 WP_011058418.1.76969 gi|70733542|ref|YP_257181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]