SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9200 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GO.9200
Domain Number - Region: 420-485
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000275
Family Anti-sigma factor antagonist SpoIIaa 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.9200
Sequence length 511
Comment $ NYCOMPS $ SQ227796 $ PDBT340721 $
Sequence
MRAAQLKSVLPRELLASVVVFLVALPLCMGIAIASGLPPAKGLITGIIGGLVVGWLAGSP
LQVSGPAAGLAVLVFELVRQHGVAMLGPILLLAGLLQLLAGRLRLGCWFRVTAPAVVYGM
LAGIGVLIVLSQVHVMLDAAPQASGLDNLVGFPQALAQALPSLGWQAGLLGLATIAVMWG
WDKWRPQALRFIPGALLGVGLATLASLLLALPVKRVEVPANLAEAIDWLRPADLLNLADP
NLLIAAFAVAFIASAETLLSAAAVDRMHSGQRSDFDRELSAQGVGNMLCGLLGALPMTGV
IVRSSANVQAGAQTRYSTIFHGLWLLGFVLVLSSVLQSIPVASLAGVLVYTGFKLVDLKV
FRGLGRYGRMPMLTYAVTALAIVFSDLLTGVLIGFALTLAKLAFKASRLKISLIDLAEEG
EMELRLVGAATFLKVPALTRVLATIPPATTVHVPLSNLSYIDHACLELLEDWNRANSAKG
SRLVIETRGLKRRLEGRLTTTSGVGAAAARG
Download sequence
Identical sequences A0A2K2WM66 Q4KKM2
WP_011058447.1.14038 WP_011058447.1.18072 WP_011058447.1.42452 WP_011058447.1.42693 WP_011058447.1.49818 WP_011058447.1.88821 GO.9200 220664.PFL_0059 gi|70733572|ref|YP_257211.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]