SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9203 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9203
Domain Number 1 Region: 406-488
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000131
Family Anti-sigma factor antagonist SpoIIaa 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9203
Sequence length 509
Comment $ NYCOMPS $ SQ227799 $ PDBT340724 $
Sequence
MFELHASKVSNLKNDVLSGLTVALALVPEAVAFAFVAGVEPLVGLYAAFIVGLITAIFGG
RPGMISGATGAMAVVMVSLVAIHGVEYLFATVVLTGVIQILAGIFKLGKFIRLVPHPVML
GFVNGLAIVIFLAQLGQFKVTNAAGELEWMQGTPLFTMAGLILLTMAIIHFFPKLTKAVP
STLVAIVGVSLLVFGIGLDTKLVGDVASIAGGLPTFSIPQVPFSFETFKIILPFALVLAA
IGLIESLLTLTLIDELTGTRGRSNKECIAQGAANTVTGFFGGMGGCAMIGQSMINVNSGG
RGRASGITAALALLGFILFASGLIEAIPLAALVGVMFIVVIGTFEWSSLRILGKVPKADA
FVIILVSGVTVYSDLAVAVIVGVIVSALVFAWEHAKHILVHRSVNEDGSTVYEVNGPIFF
GSIANFLEQFTPEDDSDDVIVEFKNARVVDHSAIEAIDTLAERYLSRNKNMHLKHLNKEC
KELLHKADKLVELNIIEDPEYHIVSDKLA
Download sequence
Identical sequences Q47WM7
GO.9203 167879.CPS_4141 gi|71277979|ref|YP_270795.1| WP_011044876.1.15195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]