SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9204 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9204
Domain Number 1 Region: 465-566
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000184
Family Anti-sigma factor antagonist SpoIIaa 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.9204
Sequence length 567
Comment $ NYCOMPS $ SQ227800 $ PDBT340725 $
Sequence
MSRAYTGALSYPQKIVIILLNKISSQHLKGDIFGGLTAAVIALPLALAFGVSSGAGAIAG
VYGAIFVGFFAALFGGTATQISGPTGPMSVVMALVFTQLIGSHPDTGLVLAFTCVILAGL
FQILFGLLKLGKYFVMVPYPVISGFMTGIGIIIILLQISPLLGSAGDSNALAALMNIPNA
LSQQNTLATVLGVITLLLMIYWPEKWTKIIPAPLFALITLTVISATFFSQQGISVIGEIP
TGFPSLSMPSLSLESLSQVSYFAFLLAVLGAIDSLLTSMVADTLTETHHDSDKELIGQGI
ANTIAGFFGALPGAGATMRTAINIRAGGKTALSGIIHSITLLIVILWAGDYAQYIPHTVL
AGMLIKVGLDIIDWRFIFQIKKVGLFSATLMLLVLLLTVFVDLITAVLVGMFIANLVTLD
RLTHIQLDNITFKRGDELLSEISSNETNIALTDDIQNNLSKSLANTLLLEIDGPVSFAVS
RELSRRFTENLAFTTLVIDLSNAKLIGTTTAIMITDLIDRTKSKEKTVLVITGNEKINQS
LDKLSLATLLDKKYQFTNREQALQTLI
Download sequence
Identical sequences Q47X32
gi|71278118|ref|YP_270638.1| GO.9204 WP_011044724.1.15195 167879.CPS_3980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]