SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9211 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9211
Domain Number 1 Region: 388-471
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000412
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9211
Sequence length 483
Comment $ NYCOMPS $ SQ227807 $ PDBT340732 $
Sequence
MLNKLKSEWLTAPGTNVLAGIVVALALIPEAISFSIIAGVDPMVGLYSSFIIAVVISFVG
GRPAMISAATGSVALVIVPLVKDHGVQYLLAATILMGIIQIIFGILKIGRLMKFIPNSVM
IGFVNALAIMIFMTQIKHIFGISIPTYLFVISTLLIIYLLPRVFNKVPAPLVAIILLTIT
YLITGAKVETVGDLGAINRSLPQFFIPDVPFNLQTLQIIFPYSLSMAIVGLVESLLTARI
VDQATDTYSSKNQESRGQGIANVVTGFFGAMGGCAMIGQSVINVRSGATTRLSTFTAGIF
LIILIIIFGDWVVQIPMPILAAIMVMVSIGTFDWRSFKFIKKAPRTDAFVMILTVAIVLI
SNNLALGVIVGVVVSALCFATKISNVVVTYEEEDDTIHYYITGQIFFVSIDSLMNQLDLE
LRHKTIYLNFKDAHLWDDSAVNAIDTLIDNYHKKNNTIYVQYLNKDSRKIVNELSKVNQQ
HLL
Download sequence
Identical sequences A0A0G7HHJ4 A0A2K3Y3F9 Q4A0G0
GO.9211 gi|73661607|ref|YP_300388.1| WP_011302282.1.10325 WP_011302282.1.18345 WP_011302282.1.18592 WP_011302282.1.25302 WP_011302282.1.27163 WP_011302282.1.28029 WP_011302282.1.31168 WP_011302282.1.37492 WP_011302282.1.43091 WP_011302282.1.43215 WP_011302282.1.45004 WP_011302282.1.48390 WP_011302282.1.53552 WP_011302282.1.59350 WP_011302282.1.68345 WP_011302282.1.74667 WP_011302282.1.76174 WP_011302282.1.8052 WP_011302282.1.91454 WP_011302282.1.99191 342451.SSP0298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]