SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9216 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9216
Domain Number 1 Region: 467-570
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.51e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9216
Sequence length 575
Comment $ NYCOMPS $ SQ227812 $ PDBT340737 $
Sequence
MDSPRIAPRPSITRPPEEDSFLALFTPKLVTMLRDGYGLGDLRADALAGLTVAIVALPLS
MAIAIASGATPEQGLFTAIVGGFLISALGGSRFQIGGPAGAFIVLVAATVAEHGFAGMIL
ATFVAGLILVAMGLLRLGTYVKFIPYPVTVGFTAGIGVVIFTTQIKDLLGLSLSGPEPGE
ILPKLMALGSALPSITPAALLISIPTIAFIVLQKRFRPGWPGMLLAVALGSFTAWLFNMP
IETVGSRFGEIPRTLPLPSMPVFSFDLLIAVLPDAAAFALLGAIESLLSAVVADGMTGRR
HRSNCELVAQGIANMASALFGGVCATGTIARTATNVRAGARGPIAGMLHALFLLGFLAVA
APLVSYIPLASLAAVLAIVAWNMIERHAFAVLLRTSRGDTVVLMATFLLTIFRDLTEGIV
AGFLIGTLLFLNRMAKATVVEADQPLIAEDRADGAFGRSAYDAALASDPRVVVYRISGAF
FFGAASTVGSVLDRIADQRKAFVLDFAAVPFLDSTAANAIEGAVRKAQRHKVKVFFTGAS
PKVRRTLLAHDLRPPRVIYKRTIDDAVTAVKAEPI
Download sequence
Identical sequences Q2RY26
gi|386348185|ref|YP_006046433.1| WP_011387925.1.3410 YP_425256.1.57063 269796.Rru_A0164 GO.9216 gi|83591504|ref|YP_425256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]