SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9232 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9232
Domain Number 1 Region: 462-569
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000294
Family Anti-sigma factor antagonist SpoIIaa 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9232
Sequence length 586
Comment $ NYCOMPS $ SQ227824 $ PDBT340753 $
Sequence
MLSDGRNPGASRKARIPNSWLRWLPGVAMARDYQASWLPRDLTAGLVLTTMLVPVGIAYA
EASGVPGVYGLYATIVPLLAYAVFGPSRILVLGPDSALAAPVLAVVVQMSGGDPARAIAV
ASMMAIVSGLFCIVMGLLRLGFITELLSKPIRYGYMNGIAFTVLVSQLPKIFAIRVEDTG
PLRELVLLGQALVAGQVNWYSAAVGAGSLVLILALKRFERVPGILIAVIVATLCVIMFDL
DQMGVKVLGSIPQGLPAFAVPWASGLDFVKIVAGGCAVAMIAFADTSVLSRSFAARHHHR
VDPNQEMVGLGAANLAAGFFQGFPISSSASRTPVAEAAGARTQLTGVVGALAVAALLVVA
PDLMRYLPNSALAAVVIAAALGLFEFADLKRIYRIQQWEFWLSMVCFVAVAVFGAIPGIG
LAVVLAIIEFLWDGWRPHYAILGQVEGLRGYHDLERYPHGKRIPGLVLFRWDAPLFFANA
ELFQERLQEAIDESPAPVYRVVVAAEPVTSVDVTSADMLRELSRTLGEHGIALHFAEMKD
PVRDKLRRFELMDVIGEDRFHPTVGSAVDDYVGRQGDWPEAWGRNE
Download sequence
Identical sequences A0A132HGJ3 Q1LGY4
gi|94312652|ref|YP_585861.1|NC_007974 266264.Rmet_3720 gi|94312652|ref|YP_585861.1| WP_011518239.1.12480 WP_011518239.1.25839 WP_011518239.1.481 WP_011518239.1.52493 WP_011518239.1.66126 GO.9232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]