SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.9234 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.9234
Domain Number 1 Region: 453-565
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000053
Family Anti-sigma factor antagonist SpoIIaa 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.9234
Sequence length 578
Comment $ NYCOMPS $ SQ227826 $ PDBT340755 $
Sequence
MGLPCVRYAPAGKTTKGIVTTTDSTHPTDSARDGSRLRDLVAGCSIAGLLLPEAVAYAGI
ANLPPQAGLIGLLVGLVVYGLAGTSRFAVVSATSSSAAVLAAITLSMSGADPAQRLLLAA
GLVILSGFFLMLAGLAKLGGITEFIAKPVLRGFTFGLAITIILKQLASVVGVHPAHNDLP
RFTYEMLGQLSAWNVNALIVALVALALLFGMSRWKNVPGPLVVIVLGIAASHGVDLHHFG
IGQVGTIDLADLSFSIPDLSRSQWLRLGELAFALVLILYAESYSSIRSFALKHGDSTSAD
RDLLALGFANLGSGLLHGMPVGAGYSATSANEAAGATSRLAGWCAAVVVAVIVALLLPQL
ALTPEPVLAAIVAYAVSHTLRLSVFRPYWSWQRDRLLVVAACVAVLLLGVLDGLLAGIVV
SLLLTLRNFSEPRVSQLGRLGTSHNYVDVSKHPEATIPPGLLIARPEAPLFFANVERILL
RVRHLAEAEQGAVHTVIISLEETPDLDGSTIEALRTFAAGVASRGRRLLLVRLKPPALDV
LTRSADDTLPLGALHELSVDEAVQSLALESIGADAPAT
Download sequence
Identical sequences Q1LEC9
GO.9234 gi|94313557|ref|YP_586766.1| gi|94313557|ref|YP_586766.1|NC_007974 266264.Rmet_4635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]