SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HR3158B from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3158B
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Immunoglobulin 2.2e-21
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HR3158B
Sequence length 91
Comment $ NESG $ SQ194710 $ PDBT158975 $
Sequence
PRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLI
FEVVRASDAGAYACVAKNRAGEATFTVQLDV
Download sequence
Identical sequences HR3158B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]