SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HR3383B from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3383B
Domain Number 1 Region: 11-173
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-42
Family DBL homology domain (DH-domain) 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HR3383B
Sequence length 175
Comment $ NESG $ SQ101989 $ PDBT137394 $
Sequence
LMKAEEAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVF
INIPELVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYI
SKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTE
Download sequence
Identical sequences HR3383B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]