SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HR3415C from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HR3415C
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.07e-22
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 
Domain Number 2 Region: 102-192
Classification Level Classification E-value
Superfamily PH domain-like 0.000000969
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HR3415C
Sequence length 193
Comment $ NESG $ SQ102100 $ PDBT137284 $
Sequence
NIYQEFVRNHQYSLQILAHCKQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYIL
TLHDVLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMIIEGCEIL
LDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSLEKEGERQCFLFSKHLIICTRGSGGKL
HLTKNGVISLIDC
Download sequence
Identical sequences HR3415C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]